Dataset for protein Mcl-1 of organism Chelydra serpentina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******.**.*********:***    **.*.******                                         
MLALKRNvVIsLNLYCGGGPsLAP----SPsGvGTPPAP-----------------------------------------
       a  g         a   pppa  n a      gardpgpsaegarpatliggaawasnghsegpraligeapr

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
arssspttppalvaggprpgplwrpeeeldgcdpdaermgppaaaaggslpstppadddddldglyqdslelisrylrea

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             ***************.*** *****:*************:*******:******************:
-------------RLLSGPRGAGPAAMEtALEtLRRVGnGVIEKHQIAFQGMvRKLDIKNkEDLKSVTAVATHVFSDGVt
aelagpggkklyk               k   m     d             l       e                  a

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *************************************:*..******************* ******************
-WGRIVTLISFGAFVAKHLKSINQETCINTLAGIITDVlVtgKRDWLVNQRGWEGFVEFFRvEDLEGSIRNVLVAFAGFA
n                                     i pd                   g                  

       330 
....:....|.
** **** **.
GLgASLAyMMr
  e    c  q
© 1998-2022Legal notice