Dataset for protein Mcl-1 of organism Chelydra serpentina

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C3T6A5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chelydra serpentina GN=MCL-1 (length=331 residues).
MLALKRNAVIGLNLYCGGGPALAPPPPASPSGAGTPPAPGARDPGPSAEGARPATLIGGAAWASNGHSEGPRALIGEAPR
ARSSSPTTPPALVAGGPRPGPLWRPEEELDGCDPDAERMGPPAAAAGGSLPSTPPADDDDDLDGLYQDSLELISRYLREA
AELAGPGGKKLYKRLLSGPRGAGPAAMEKALETLRRVGDGVIEKHQIAFQGMLRKLDIKNKEDLKSVTAVATHVFSDGVT
NWGRIVTLISFGAFVAKHLKSINQETCINTLAGIITDVLVTDKRDWLVNQRGWEGFVEFFRVEDLEGSIRNVLVAFAGFA
GLGASLAYMMR
>gnl|bcl2dbpro|A0A8C3TAL3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chelydra serpentina GN=MCL-1 (length=192 residues).
MLALKRNVVISLNLYCGGGPSLAPSPNGVGTPPAPRLLSGPRGAGPAAMETALEMLRRVGNGVIEKHQIAFQGMVRKLDI
KNEEDLKSVTAVATHVFSDGVAWGRIVTLISFGAFVAKHLKSINQETCINTLAGIITDVIVPGKRDWLVNQRGWEGFVEF
FRGEDLEGSIRNVLVAFAGFAGLEASLACMMQ
© 1998-2022Legal notice