Dataset for protein Mcl-1 of organism Chelydra serpentina

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3T6A5_MCL1-01      MLALKRNAVIGLNLYCGGGPALAPPPPASPSGAGTPPAPGARDPGPSAEG
A0A8C3TAL3_MCL1-01      MLALKRNVVISLNLYCGGGPSLAP----SPNGVGTPPAP-----------
                        *******.**.*********:***    **.*.******           

A0A8C3T6A5_MCL1-01      ARPATLIGGAAWASNGHSEGPRALIGEAPRARSSSPTTPPALVAGGPRPG
A0A8C3TAL3_MCL1-01      --------------------------------------------------
                                                                          

A0A8C3T6A5_MCL1-01      PLWRPEEELDGCDPDAERMGPPAAAAGGSLPSTPPADDDDDLDGLYQDSL
A0A8C3TAL3_MCL1-01      --------------------------------------------------
                                                                          

A0A8C3T6A5_MCL1-01      ELISRYLREAAELAGPGGKKLYKRLLSGPRGAGPAAMEKALETLRRVGDG
A0A8C3TAL3_MCL1-01      -----------------------RLLSGPRGAGPAAMETALEMLRRVGNG
                                               ***************.*** *****:*

A0A8C3T6A5_MCL1-01      VIEKHQIAFQGMLRKLDIKNKEDLKSVTAVATHVFSDGVTNWGRIVTLIS
A0A8C3TAL3_MCL1-01      VIEKHQIAFQGMVRKLDIKNEEDLKSVTAVATHVFSDGVA-WGRIVTLIS
                        ************:*******:******************: *********

A0A8C3T6A5_MCL1-01      FGAFVAKHLKSINQETCINTLAGIITDVLVTDKRDWLVNQRGWEGFVEFF
A0A8C3TAL3_MCL1-01      FGAFVAKHLKSINQETCINTLAGIITDVIVPGKRDWLVNQRGWEGFVEFF
                        ****************************:*..******************

A0A8C3T6A5_MCL1-01      RVEDLEGSIRNVLVAFAGFAGLGASLAYMMR
A0A8C3TAL3_MCL1-01      RGEDLEGSIRNVLVAFAGFAGLEASLACMMQ
                        * ******************** **** **.

© 1998-2022Legal notice