Dataset for protein BCL-2-like of organism Castor canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------matpaslpd---------
mfglkrnaviglnlycggaglgagsggattpprgrllaaeeasarrevgggeagaviggsamaqs---a--pwrrvarpa
                                                             gsspgrt-ytdalqs aa 
                                                              cpd lrgrq         
                                                                a  kege         
                                                                   a a          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              : .                                               
----------------------tralvadylgyklrqkgy----------------------------------------
pvsgesprgtccgkmsegefafntetpvrfvshvpsvr--twsqmsdvgsvrtmspeetpdpgipspvptssavppnpsw
 igaci d              vh-iltklirfcatrqasspkefeapeengiep  aelagyefefqgkrpplngllrl
                      e   aq   q a qep  e      aaddaaaa         e elegpn ilaa ed
                           m   h                                                
                               f                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 .:* ..         
----------------gagppe----------------------------------gpaatpvhqalRaagdefetryrr
vlvrttsvsppvspvs-p-agleeedelyrqsleiicrylreqatgakdakpmggsvlpsdklarvm rva---qrnfet
rgedspappgdtglsct-p-aa                                  sivpsvallt  q  fsv-lev k
haaa k lnaagahpasld r                                   pagmraeke   e   gise l  
              a r                                           p   a   d   d    h  
                e                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .            :  :    * .  *  ****:*::  *.. :                             
tfsdllsqlhvtp-gtavqrftqvveelFsd--Gv-NWGRiVaffvFggalcvesvnkemeplvsqvaew----------
alqpmaakydiysvfsrrtsmarmsdkv rgnr pt    l tlis aavv-k-li---qsvgpgviq--ktrhevardc
shwgytrrcilkq endqkllst mnht q    li    v  iaa   tmiak--srrlqsdidt--s           
r aefsd   gan dd ygi  aiae e               e   f a-h lriniarc eryml           
d  a f            e                                  kde       p              
                                                                 n              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :   :   :      *:  . **   *   :                        .                      
--mvaylntrlvd----WiqsngGWd-gFvelygpgalee-rr-re----nwlsvrtvltgav-lgvlvtlgayf--k--
prlaesvedhiatttre lhqsr  ane taffrd-v---a--l--lfnfvla-l--ltgvtla--a-i----f-as-lh
  isylitrv hrqkgd  vkq   e t iqk hvssapltiwrqrg d s ttfsgfistiygvd-v-rvrs-ywtq  
   itf cef epnh a  ke      a ck  etnp agsfkn pr   r ff-le aemga aaycsl  mllsr   
       aa   n      ed             nkd   g  g      i  a kc  al     m l   l  gh   
            g       a              e              g    a    k                   

  
..
  
--
kf
  
  
  
  
© 1998-2023Legal notice