Dataset for protein BCL-2-like of organism Castor canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :      .* :* .:: *** *.**                                                    
-mqtpasapdtRelVadfvgYKLsQkGY----------------------------------------------------
msas------n ai vkyls   r r  swsqfsdvgevrteppeatpapgifsfvptssplpgnpswrlvrttsvpppv
 a agrtgy      m  ih        e      aedngaaa         e eqegpnainaa rdhaadspalngat

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .  ..        :: ::* ***:*. *:** *:::::***:** :*   *  * :***..* ****:**** **..
--vcgagpgegpaadpvhqamRaAGDeFetRyRRtFsdlasQLHvTPgtAqqrFtqVvdELFrgGvNWGRlVAFFvFGga
gpsssldarlvivptvlkltl q   d sr f  d aemta   l  fs ygs et sn   qd p    i    s  av
ahaa  a s pmpa      e      l    a    s    i     r     e                e    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:*.**::.**. **..:  **  **: .*  **:..***  *. *** ..       .      *      * . .  *.
lCvESvnkEMepLVgqvqeWMvaYLntrLadWIqssGGWdeFveLYGdgaleearrlreg---nWasvrt-LtgavalGv
m a  idr  sv  srias  it  erh ht  hen   at ta   psv-------qprfnfs l----v lsmtvv a
          q   dn  l  ae   d  ep       a      naa s kg  l d r f lk     lala  

       250 
....:....|.
 : :*: :. *
lvtvGaffasK
vl-l sylsr 
ci    l gh 
© 1998-2020Legal notice