Dataset for protein BCL-2-like of organism Castor canadensis

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A250YBR2_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Castor canadensis GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESINKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A250YBR2_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Castor canadensis GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESINKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A250YD48_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Castor canadensis GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGIESEVETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMTAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A250YD83_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Castor canadensis GN=BCL-2 (length=239 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPEATPAPGIFSFQPGSNPLPAAPRDRAARTTSLPPPVAPAA
RAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMIEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGVCITLGAYLGHK
>gnl|bcl2dbpro|A0A8C0WAG3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Castor canadensis GN=BCL2A1 (length=208 residues).
MCPTPAKLGEPWLQSAAAAPVSGCSPRGTCCGKMSEGEFAFTHALAQDYLRHVLQVQPAGLGASKAARVLRDVAFSIQEE
VEKSLQPYLDKCDVASVDTARTIFNQVMEKEFEDGVINWGRIVTIFAFGGVLIKKLLRERIAPDVDTYMEISYFVAEFIV
NNTGEWIKQNGGWENGFIKKFEPKSGWLTFLEVIEKIYDMLSLLRLYY
>gnl|bcl2dbpro|A0A8C0WJK2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Castor canadensis GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATTPPRGRLLAAEEASARREVGGGEAGAVIGGSAGASPPAALAQDARRVARPA
PIGAEIPDVTATPARLLFFAPTRRASTPKEMEAPASDAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEATKSPSADGSL
PSTPPPAEEEEDELYRQSLEIICRYLREQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C0XBQ2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Castor canadensis GN=BCL2L10 (length=188 residues).
MADPLRERTERLLTDYLQYCAREPEPGAPEPPPSTPEAAVLRAAATRLRRRHWAFFSRYIGYQGNRVELMARMAEATFSD
NRGLNWGRVVTLAAFAGTLLERGPSVVAEWKTRHEVARDCPRLVALLCARLVGQHRAWLEAQGGWDGFCQFFRTPLPLTF
WRRRLIWTFLSCFLATALMYFWTQLHKF
© 1998-2023Legal notice