Dataset for protein BCL-2-like of organism Castor canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A250YBR2_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------------------
A0A250YBR2_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------------------
A0A250YD48_BCL2L1-      MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE-----
A0A250YD83_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEW----DAGDVGAAPPEATPAP
                           :      .* :* .:: *** *.**                      

A0A250YBR2_BCL2L2-      --------------------------------VCGAGPGEGPAADPLHQA
A0A250YBR2_BCL2L2-      --------------------------------VCGAGPGEGPAADPLHQA
A0A250YD48_BCL2L1-      GIESEVETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMTAVKQA
A0A250YD83_BCL2-01      GIFSFQPGSNPLPAAPRDRAARTTSLPPPVAPAARAGPALSPVPPVVHLT
                                                         .  ..        :: :

A0A250YBR2_BCL2L2-      MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGR
A0A250YBR2_BCL2L2-      MRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGR
A0A250YD48_BCL2L1-      LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGR
A0A250YD83_BCL2-01      LRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGR
                        :* ***:*. *:** *:::::***:** :*   *  * :***..* ****

A0A250YBR2_BCL2L2-      LVAFFVFGAALCAESINKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA
A0A250YBR2_BCL2L2-      LVAFFVFGAALCAESINKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA
A0A250YD48_BCL2L1-      IVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWD
A0A250YD83_BCL2-01      IVAFFEFGGVMCVESVNREMSPLVDNIALWMIEYLNRHLHTWIQDNGGWD
                        :**** **..:*.**::.**. **..:  **  **: .*  **:..*** 

A0A250YBR2_BCL2L2-      EFTALYGDGALEEARRLREG---NWASVRTVLTGAVALGALVTVGAFFAS
A0A250YBR2_BCL2L2-      EFTALYGDGALEEARRLREG---NWASVRTVLTGAVALGALVTVGAFFAS
A0A250YD48_BCL2L1-      TFVELYGNNAAAESRKGQERFN-RWF-----LTGMTVAGVVL-LGSLFSR
A0A250YD83_BCL2-01      AFVELYGPSV-------RPLFDFSWLSLKT-LLSLALVGVCITLGAYLGH
                         *. *** ..       .      *      * . .  *. : :*: :. 

A0A250YBR2_BCL2L2-      K
A0A250YBR2_BCL2L2-      K
A0A250YD48_BCL2L1-      K
A0A250YD83_BCL2-01      K
                        *

© 1998-2020Legal notice