Dataset for protein BCL-2-like of organism Castor canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0WJK2_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATTPPRGRLLAAEEASARREVGG
A0A8C0WAG3_BCL2A1-      --------------------------------------------------
A0A250YD48_BCL2L1-      --------------------------------------------------
A0A250YD83_BCL2-01      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A250YBR2_BCL2L2-      --------------------------------------------------
A0A8C0XBQ2_BCL2L10      --------------------------------------------------
                                                                          

A0A8C0WJK2_MCL1-01      GEAGAVIGGSAGASPPAALAQDARRVARPAPIGAEIPD------------
A0A8C0WAG3_BCL2A1-      -----------MCPTPAKLGEPWLQSAAAAPVSGCSPRGTCCGKMSEGEF
A0A250YD48_BCL2L1-      -----------MSQS-----------------------------------
A0A250YD83_BCL2-01      -----------MAQAGRTGYD-----------------------------
A0A250YBR2_BCL2L2-      ------------MATPASAPD-----------------------------
A0A250YBR2_BCL2L2-      ------------MATPASAPD-----------------------------
A0A8C0XBQ2_BCL2L10      ------------MADPLRERT-----------------------------
                                                                          

A0A8C0WJK2_MCL1-01      --VTATPARLLFFAPTRRASTPKEMEAPASDAIMSPEEELDGYEPEPLGK
A0A8C0WAG3_BCL2A1-      AFTHALAQDYLRHVLQVQ--------------------------------
A0A250YD48_BCL2L1-      --NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE-----GIESEVET
A0A250YD83_BCL2-01      --NREIVMKYIHYKLSQRGYEW----DAGDVGAAPPEATPAPGIFSFQPG
A0A250YBR2_BCL2L2-      --TRALVADFVGYKLRQKGY------------------------------
A0A250YBR2_BCL2L2-      --TRALVADFVGYKLRQKGY------------------------------
A0A8C0XBQ2_BCL2L10      --ER-LLTDYLQYCAREP--------------------------------
                                  : .                                     

A0A8C0WJK2_MCL1-01      RPAVLPLLELVGEATKSPSADGSLPSTPPPAEEEEDELYRQSLEIICRYL
A0A8C0WAG3_BCL2A1-      ------------------------------PA------------------
A0A250YD48_BCL2L1-      PSAINGNPSWHLVDSPAVNGATGHSSSLDARE------------------
A0A250YD83_BCL2-01      SNPLPAAPRDRAARTTSLPPPVAPAARAGPAL------------------
A0A250YBR2_BCL2L2-      ------------------------VCGAGPGE------------------
A0A250YBR2_BCL2L2-      ------------------------VCGAGPGE------------------
A0A8C0XBQ2_BCL2L10      --------------------------EPGAPE------------------
                                                                          

A0A8C0WJK2_MCL1-01      REQATGAKDAKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLD
A0A8C0WAG3_BCL2A1-      ----------------GLGASKAARVLRDVAFSIQEEVEKSLQPYLDKCD
A0A250YD48_BCL2L1-      ----------------VIPMTAVKQALREAGDEFELRYRRAFSDLTSQLH
A0A250YD83_BCL2-01      ----------------SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
A0A250YBR2_BCL2L2-      ----------------GPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLH
A0A250YBR2_BCL2L2-      ----------------GPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLH
A0A8C0XBQ2_BCL2L10      ----------------PPPSTPEAAVLRAAA----TRLRRRHWAFFSRYI
                                                 .:* ..                .  

A0A8C0WJK2_MCL1-01      IKN-EDDVKSLSRVMIHVFSD--GVTNWGRIVTLISFGAFVAKHLKSINQ
A0A8C0WAG3_BCL2A1-      VASVDTARTIFNQVMEKEFED--GVINWGRIVTIFAFGGVLIKKLLRERI
A0A250YD48_BCL2L1-      ITP-GTAYQSFEQVVNELFRD--GV-NWGRIVAFFSFGGALCVESVDKEM
A0A250YD83_BCL2-01      LTP-FTARGRFATVVEELFRD--GV-NWGRIVAFFEFGGVMCVESVNREM
A0A250YBR2_BCL2L2-      VTP-GSAQQRFTQVSDELFQG--GP-NWGRLVAFFVFGAALCAESINKEM
A0A250YBR2_BCL2L2-      VTP-GSAQQRFTQVSDELFQG--GP-NWGRLVAFFVFGAALCAESINKEM
A0A8C0XBQ2_BCL2L10      GYQ-GNRVELMARMAEATFSDNRGL-NWGRVVTLAAFAGTL--------L
                                  :  :    * .  *  ****:*::  *.. :         

A0A8C0WJK2_MCL1-01      ESCIEP----------------LAESITDVLVRTKRDWLVKQRGWD-GFV
A0A8C0WAG3_BCL2A1-      APDVDTYME-------------ISYFVAEFIVNNTGEWIKQNGGWENGFI
A0A250YD48_BCL2L1-      QVLVSRIASW------------MATYLNDHLEP----WIQENGGWD-TFV
A0A250YD83_BCL2-01      SPLVDNIALW------------MIEYLNRHLHT----WIQDNGGWD-AFV
A0A250YBR2_BCL2L2-      EPLVGQVQEW------------MVAYLETRLAD----WIHSSGGWA-EFT
A0A250YBR2_BCL2L2-      EPLVGQVQEW------------MVAYLETRLAD----WIHSSGGWA-EFT
A0A8C0XBQ2_BCL2L10      ERGPSVVAEWKTRHEVARDCPRLVALLCARLVGQHRAWLEAQGGWD-GFC
                                              :   :   :      *:  . **   * 

A0A8C0WJK2_MCL1-01      EFFHVEDLEGGIRN------VLLAFAGVAGVGAGLAYLIR----------
A0A8C0WAG3_BCL2A1-      KKFEPKS-------------GWLTFLEVIEKIY--DMLSLLRLYY-----
A0A250YD48_BCL2L1-      ELYGNNAAAESRKGQERFN-RWF----LTGMTV-AGVVL-LGSLFSRK--
A0A250YD83_BCL2-01      ELYGPSV-------RPLFDFSWLSLKTLLSLAL-VGVCITLGAYLGHK--
A0A250YBR2_BCL2L2-      ALYGDGALEEARRLREG---NWASVRTVLTGAVALGALVTVGAFFASK--
A0A250YBR2_BCL2L2-      ALYGDGALEEARRLREG---NWASVRTVLTGAVALGALVTVGAFFASK--
A0A8C0XBQ2_BCL2L10      QFFRT-PLPLTFWRRRL---IWTFLSCFLATAL---------MYFWTQLH
                          :                        .                      

A0A8C0WJK2_MCL1-01      --
A0A8C0WAG3_BCL2A1-      --
A0A250YD48_BCL2L1-      --
A0A250YD83_BCL2-01      --
A0A250YBR2_BCL2L2-      --
A0A250YBR2_BCL2L2-      --
A0A8C0XBQ2_BCL2L10      KF
                          

© 1998-2023Legal notice