Dataset for protein BCL-2-like of organism Carlito syrichta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----sapdtrelvadf--yklrqkgyv------------------------------------------------csap
matpa--e---a-----vg---------wsqfsdveenrteasegtesemetpsavngnpswkrvgsrpvngatgh-g-g
 mmepms-snk- qveyls casppqss                                m hltdlpaqk     s-s-
  adeleqrlar ln v e    e  mp                                                mprl
     e  k                  n                                                e p 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     :      :  .  .: :.       .                   . .: . *.     
pge-gpvadslhqamraagdef---evryrrtfsdlaaqlh-tpgsayqsftqvvnelfrggpnwgrlvaffvFggalcv
---e--a--p----l-----slyvgstdfppsvvsmtth--v--ltgsvrre--sd---qd-v---kiftyvs satesa
ssravi-mr-vker-eqrhr-ifsanr wggprpe esrmaiav c qrnlvti--dk --h-    v  lit adk le
dap aaplmateak  edaa     fl   aaae     f d       d s  lc   s       g    e       
  n    ia ia                                                                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                .                  : .    .                                     
esvnkemevlvsrvqtw------------------mvaylntrlepwiqssggwd-------------------------
rtsllpdqpqqrqiaerrkkeegdvardcqrlvalvatrredhpad--hdn----leaikarvremeeeaeklkelqnev
 gpdalags fggrrpk                  lspk tn hr- l---   e                         
        g    f i                    i   ag  ga   aq   a                         
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdk
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  .                     :   .          . .     :
----------------------------tfvslygrgapresrrgre----ssrswfytgm-------vyrgvvrlgswf
esvrtslaldeslfrgrqikvipkrtnr--iettdnnfaaarykaqttnynrfnrrllsrfnsrprgrtvaaralatfly
                            pgtvffstpll--------g wa---tv wravpvqafvscll m tvyafw
                            g ca   d   e a  l       v lt tg l       a g l fi    
                            e                                                   

    
....
:   
srk-
tpyl
asl 
    
    
© 1998-2022Legal notice