Dataset for protein BCL-2-like of organism Carlito syrichta

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A1U7T4L4_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Carlito syrichta GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLSRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAT
WMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A1U7T4L4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Carlito syrichta GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEASEGTESEMETPSAVNGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A1U7UJF2_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Carlito syrichta GN=BCL2L2 (length=178 residues).
MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKF
SGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP
RGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A1U7UJF2_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Carlito syrichta GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A1U7UJF2_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Carlito syrichta GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A1U7UZD8_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Carlito syrichta GN=BCL2L10 (length=195 residues).
MADPLEERTARLLADYLEYCARPPGSPEPRPSSPEAAVLRSTAARLRQRHASFFSAFVDYPGSRVDLTARMADAVLSGSR
DLSWGRVVTLVTFAGTLLERGPLLPAGGQQRGFRPRRKKEEGDVARDCQRLVALLSARLAGRHRAWLQAQGGWDGFCVFF
STPLPLTFWRRLPVQAFVSCLLAMAFIYFFWTRLL
© 1998-2022Legal notice