Dataset for protein BCL-2-like of organism Carlito syrichta

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U7UJF2_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEASEGTESEM
A0A1U7UZD8_BCL2L10      -MADPLEERTARLLADYLEYCARPPGSP----------------------
A0A1U7UJF2_BCL2L2-      --MEEEAEKLKELQNEV------EKQMN----------------------
A0A1U7UJF2_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYV----------------------
                                                                          

A0A1U7UJF2_BCL2L2-      --------------------------CGAGPGE-GPAADPLHQAMRAAGD
A0A1U7T4L4_BCL2L1-      ----------MWKRTGLRPQKG----------------------------
A0A1U7T4L4_BCL2L1-      ETPSAVNGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGD
A0A1U7UZD8_BCL2L10      --------------------------EPRPSSPEAAVLRSTAARLRQRHA
A0A1U7UJF2_BCL2L2-      --------------------------MSPPPGNAGPVIMSIEEKMEADAR
A0A1U7UJF2_BCL2L2-      --------------------------CGAGPGE-GPAADPLHQAMRAAGD
                                                                          

A0A1U7UJF2_BCL2L2-      EF---ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVA
A0A1U7T4L4_BCL2L1-      -L---SRRWRPPVPSMATH----PGTAYQSFEQVVNELFRDGVNWGRIVA
A0A1U7T4L4_BCL2L1-      EF---ELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVA
A0A1U7UZD8_BCL2L10      SFFSAFVDYPGSRVDLTARMADAVLSGSRDLS------------WGRVVT
A0A1U7UJF2_BCL2L2-      SIYVGNVDYGATAEELEAHFH---GCGSVNRVTILCDKFSGHP---KGFA
A0A1U7UJF2_BCL2L2-      EF---ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVA
                         :      :  .  .: :.       .                   . .:

A0A1U7UJF2_BCL2L2-      FFVFGAALCAESVNKEMEPLVGQVQEW------------------MVAYL
A0A1U7T4L4_BCL2L1-      FFSFGGALCVESVDKEMQVLVSRIATW------------------MATYL
A0A1U7T4L4_BCL2L1-      FFSFGGALCVESVDKEMQVLVSRIATW------------------MATYL
A0A1U7UZD8_BCL2L10      LVTFAGTLLERGPLLPAGGQQRGFRPRRKKEEGDVARDCQRLVALLSARL
A0A1U7UJF2_BCL2L2-      YIEFSDKESVRTSLALDESLFRGRQIK------------------VIPKR
A0A1U7UJF2_BCL2L2-      FFVFGAALCAESVNKEMEPLVGQVQEW------------------MVAYL
                         . *.                     .                  : .  

A0A1U7UJF2_BCL2L2-      ETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPP
A0A1U7T4L4_BCL2L1-      NDHLEPWIQDNGGWD-----------------------------------
A0A1U7T4L4_BCL2L1-      NDHLEPWIQDNGGWD-----------------------------------
A0A1U7UZD8_BCL2L10      AGRHRAWLQAQGGWD-----------------------------------
A0A1U7UJF2_BCL2L2-      TNRPG---------------------------------------------
A0A1U7UJF2_BCL2L2-      ETRLADWIHSSGGWA-----------------------------------
                          .                                               

A0A1U7UJF2_BCL2L2-      GNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTI
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A1U7T4L4_BCL2L1-      --------------------------------------------------
A0A1U7UZD8_BCL2L10      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
                                                                          

A0A1U7UJF2_BCL2L2-      LCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG
A0A1U7T4L4_BCL2L1-      ------------------------------------------------TF
A0A1U7T4L4_BCL2L1-      ------------------------------------------------TF
A0A1U7UZD8_BCL2L10      ------------------------------------------------GF
A0A1U7UJF2_BCL2L2-      --------------------------------------------------
A0A1U7UJF2_BCL2L2-      ------------------------------------------------EF
                                                                          

A0A1U7UJF2_BCL2L2-      ISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWY
A0A1U7T4L4_BCL2L1-      VELYGNNAAAESRKGQE----RFNRWFLTGM-------TVAGVVLLGSLF
A0A1U7T4L4_BCL2L1-      VELYGNNAAAESRKGQE----RFNRWFLTGM-------TVAGVVLLGSLF
A0A1U7UZD8_BCL2L10      CVFFSTPLP---------------LTFWRRLPVQAFVSCLLAMAFIYFFW
A0A1U7UJF2_BCL2L2-      ISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWY
A0A1U7UJF2_BCL2L2-      TALYGDGALEEARRLREGNWASVRTVLTGAV-------ALGALVTVGAFF
                            .                     :   .          . .     :

A0A1U7UJF2_BCL2L2-      SPY-
A0A1U7T4L4_BCL2L1-      SRK-
A0A1U7T4L4_BCL2L1-      SRK-
A0A1U7UZD8_BCL2L10      TRLL
A0A1U7UJF2_BCL2L2-      SPY-
A0A1U7UJF2_BCL2L2-      ASK-
                        :   

© 1998-2022Legal notice