Dataset for protein Bcl2l10 of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MREGAGRRQAHKTGRGRPPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPL
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
YRRYRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALLCAQFCEKHRA
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************                                
WLMANGGWDGFCLSFSHSLQPSWERHLVWFFLSYWTAIIIIYFWIKLS--------------------------------
                                                ntqkvsessledlekgikvltcldlwnqvtek
                                                agfi                            

  
..
  
--
sc
  
© 1998-2022Legal notice