Dataset for protein Bcl2l10 of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2PEQ8_BCL2L10      MREGAGRRQAHKTGRGRPPGRGGAMVDPFRERTARLLMDYLEFCAREPGT
A0A8C2PEQ8_BCL2L10      MREGAGRRQAHKTGRGRPPGRGGAMVDPFRERTARLLMDYLEFCAREPGT
A0A8C2PEQ8_BCL2L10      MREGAGRRQAHKTGRGRPPGRGGAMVDPFRERTARLLMDYLEFCAREPGT
                        **************************************************

A0A8C2PEQ8_BCL2L10      PAPAPSTPEAAVLRHVAARVLEANRNVLPLYRRYRRHRVELVARMAQRLL
A0A8C2PEQ8_BCL2L10      PAPAPSTPEAAVLRHVAARVLEANRNVLPLYRRYRRHRVELVARMAQRLL
A0A8C2PEQ8_BCL2L10      PAPAPSTPEAAVLRHVAARVLEANRNVLPLYRRYRRHRVELVARMAQRLL
                        **************************************************

A0A8C2PEQ8_BCL2L10      DEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALL
A0A8C2PEQ8_BCL2L10      DEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALL
A0A8C2PEQ8_BCL2L10      DEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALL
                        **************************************************

A0A8C2PEQ8_BCL2L10      CAQFCEKHRAWLMANGGWDGFCLSFSHSLQPSWERHLVWFFLSYWTAIII
A0A8C2PEQ8_BCL2L10      CAQFCEKHRAWLMANGGWDGFCLSFSHSLQPSWERHLVWFFLSYWTAIII
A0A8C2PEQ8_BCL2L10      CAQFCEKHRAWLMANGGWDGFCLSFSHSLQPSWERHLVWFFLSYWTAIII
                        **************************************************

A0A8C2PEQ8_BCL2L10      IYFWIKLSNGFIVSESSLEDLEKGIKVLTCLDLWNQVTEKSC
A0A8C2PEQ8_BCL2L10      IYFWIKLSATQK------------------------------
A0A8C2PEQ8_BCL2L10      IYFWIKLS----------------------------------
                        ********                                  

© 1998-2022Legal notice