Dataset for protein Bcl2l10 of organism Capra hircus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C2PEQ8_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Capra hircus GN=BCL2L10 (length=212 residues).
MREGAGRRQAHKTGRGRPPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPL
YRRYRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALLCAQFCEKHRA
WLMANGGWDGFCLSFSHSLQPSWERHLVWFFLSYWTAIIIIYFWIKLSATQK
>gnl|bcl2dbpro|A0A8C2PEQ8_BCL2L10-03 BCL2-like 10 protein OS=[Eukaryota] Capra hircus GN=BCL2L10 (length=208 residues).
MREGAGRRQAHKTGRGRPPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPL
YRRYRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALLCAQFCEKHRA
WLMANGGWDGFCLSFSHSLQPSWERHLVWFFLSYWTAIIIIYFWIKLS
>gnl|bcl2dbpro|A0A8C2PEQ8_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Capra hircus GN=BCL2L10 (length=242 residues).
MREGAGRRQAHKTGRGRPPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPL
YRRYRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALLCAQFCEKHRA
WLMANGGWDGFCLSFSHSLQPSWERHLVWFFLSYWTAIIIIYFWIKLSNGFIVSESSLEDLEKGIKVLTCLDLWNQVTEK
SC
© 1998-2022Legal notice