Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-maa-ataydnrelvgdfvhyklrqrgy----vcgag--pgeg-------pap---------------------------
m---p-sgp-t-aifmkyigavislkllewdageagaapanaafmflwptgpsgisasqpgrapapartspppppaapaa
 ahtgr---a-a-maalkrsgpggrnh saqrcgfsrlgeast       aeaegtsremetpsvingnpswhlads lv
  q asmsqsa ga-vgrgnsh fggs d  vspvedgel v        etgssfefllasgatvhvprgmasttr es
    m aiaec s-l---lm    tq       s d vl  r             gge e an kd thldgsrrc   r
                rn-              q   r                  d          kei   a      
                  k              d                                              
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------dvvhqalraagdeferryrrtfs-------elsaqlhvtpgtarqr----------------
aaaaaaaaagpapspvpmpplgltmaqgsedtst-fg-d-aagaviggdmasspplelfpdqgsrvlqdvafsvqgqvek
ngvtghsssldtrevirgsagdrlngsektaltpn--g-gelaqdyvrsalle etknesearp                
ppeprqptthr sgss  gsekygrplvrrmvqleeeygl-       hvgrr qph adsee                 
hi    drp   l     arapsrg r p gipc h ta q       gstqk dig   ryp                 
                  tk lg   e h   d               a  ci  s     vk                 
                  re ee   v                                   a                 
                          g                                                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  . .                                           
--------------------faqvseelfrd-Gpnwgrivaffvfgaalcvesvnkemeplv-------gqiaewmteyl
nlkpcldsfdvvsvdtartivttpvpigaqgpvvgvsalpprlellgvmaaalppryes---vegdpgddnvqdaivape
                    prrradp--e-g tss -t----l---pptrgcqeertqvglda     spael--ms--
                    lepamn-v p   s r t-ltvr-ae --mpk ldqnqlsdi       ealsayv--vi
                     s  i-ke -   i    r  sis   iv kh ksi i  c        ar  ys atf 
                     n   vh  s           l r   fr td efg              l   f rh  
                     h                     a                          k      d  
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
erhl-dwiqsnggwe-----------------------------------------------------------------
n---h---------dleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdyga
-trqatplhdsrspa dgyepeplgkrpavlp l  vg assgpg dgslpstp paeeeddelyrqsle isrylreq 
vdtmrp avera rs qdvafs q qv k                       lk cld f vvsvdt  t fnqvmeke 
tipkeg  rqq   v                                                                 
q n p   pk    m                                                                 
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----lfvhlygcga--r---------------------------------------------------------sllldf
taeedeaefh-stsvn-vtilclrrvgdgvqrnhedkfsghpkgfayiefsdkesvsrvivhvfsdgvtnwgrt--af--
 gakaakp-gsprmasekrlet q           ta q mlrkldikned vk l      lper prr  kiqt--se
    ----m-v---le aa                     wvc v                   c   i    gvpcvys
    thta v dne a s                                                        kerinr
    ewpl l na                                                             f v h 
    p  f   ll                                                                 a 
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
slfrgrqi------------------------prarwrarttnynssrsrf------------------------g--y-
-----k-llekvipkrtnrpgisttdrgflvr----ylgscitw-------hvedleggirnvllaysgfnsrpr-ra-r
gwlsl-a-  qs nqescieplaesitdvit lsrdlvla-gg-ggyvghl            ngffakvagvggalvll
waivamhv   r ssqvdaakvcyfvws    tkla-i--q--ldaflefk               vk  epktawvtfg
vypthqtq      hdk    f rccae    agvv -vkersracvdtv                      isnki   
ef lv s                         dphl prqlsdfsngfrc                              
 g kt k                         nmws fphsfa k   vk                              
      c                            p    np  e                                   

       490       
....:....|....:..
                 
-r---------------
g-aratswyspylkqyy
ilvtvgaffask     
avlgtvcemw h     
e        l       
                 
                 
                 
© 1998-2023Legal notice