Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        ..                                      
---------d-r-mvglyrnyklg---qrgyewgag-lgagpggaspspg------------------------------
mahagrtgy-n-eifmkkihaviswmtlkltcgddeeadeas-ahasagqistsqpeshpepartrpprasgsprgtrla
 matpasaprtqal-adfvg--vrflf-np-vesvadpa  avv telhpafscr gra a rqpsdhpppaasaaaaap
 sqlfggsr g r-s-----pl--   t-- pcm   e    p  dai    af    n t  vh  ma rt  lrpiv 
 cp       a ktgvsrslca      w  --    v    l  g t                                
             c  ep f        q             a                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                .                               
-------------------------------------------rlraagdefstryrrdfgemsaqlhvtpgta------
srraggprmtdcefgytlalaqdyvrhvlqipqpspvppvvhltmlqvardvtr-vegtgapagsviglvafdtppttla
aadta                           alg a srasrvgqds fsaqgqr-knlsdlldsfdgssvss      
    t                           t          a srt ---e- fp-g-k-ca--------a-      
                                              gp krr-l -  - - --egap g  -y      
                                                    h     a                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-rgrfaqvveelfrdGv-nwgrivafflfggvlcvesvnremsplvd--nvalwmteylnrhlhdwiqdnggw-----l-
p-----t------qg-pi-vsalppvlellapmtrklpeeriespaaaeqi-------------t--------dafve-y
aqtirv-rsspigee - e---t-tr-v-e-ip-ka-lpq---gd-g  k-sysvvafittymr-plrsspavlplla v
 dq  ta pdke a- l  see-e--ea -ea-pa-e--k pp--r-  daqmfpe e egrepe  hqr   en t   
  a  n  m    -n          e -   -e -p   -   r     - ie  a   d n a   gk    ae     
             g                    e              p                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
g-------------------------------------------------------------kpl------s-kal--l-
-passgpgmdgslpstpppaeeeedeepglvegdpgdgalyrqsleiisryvreqetgaktm---ggsswl-r---lt-a
 e      ap pg gsga gsq  e              iedpe  a karl  maee edaqe fdfraaqlnmsespr
 d                                                          kl   qnevek m   pp g
                                                                               q
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        *                       
-vg--v--------------------------------------------------Gaykgfk--------s----l---
r--dg-trnhetafqgmlrkldikneddvkslsrvivhvfsdgvtnwgrivtlisf hfva-ehlksinqe-vrtp-aes
la aciqlsi ekmeada siyvg v ygataeelea fhgc sv rvt lcdkfs fvlkhayiefsdka cies tga
n  p  im                                                  peearr reg w     v    
                                                          l                     
                                                                                

       410       420       430       440       450       460       470     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
                                                                           
----------------------------gf--f--v----------l-----------g----------------
itdvlvrtkrdwlvkqrgwrpgisttkd--ve-fh-edteggirsv-layagvagvga-layliraratswyspy
ldesaf grqikvipk tn      pds wptaryrlrlvnynwnrsrqfy fnsrpr rvfrgk          
valg l                     r  lr le ag tcems h kf s     tv af as           
                                                                           
                                                                           
© 1998-2022Legal notice