Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------agsgrtssdnrrlvadf--ykl-----------------
mtqpgtrfwrgsehsiradmfglkrnavimlnlycggaglgmat--sgpsggeilmk-vh---igkerkkdwrfslflpg
                   saka vpy  gaqswaarlram--apgaay-t-a----yigatt                 
                             svpglmvhcfgrsh-ta---g-q-rpvvgrenvw                 
                             rtgaaesa adpfygaqrpqpp g hltpmtgls                 
                               a         etd  pcg e    gsllsfge                 
                                          qc  m           km                    
                                              g           ga                    
                                                          f                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------------rqkgy-w
rladpegtagwgwqqnpqdlpaqrfrkvntqifqrrskveqgprlpdfrpgvtgqptrrrsawkpsagpwesgs----v-
                                                                         -rrpgeg
                                                                         pteetpc
                                                                         asp sge
                                                                          g  as 
                                                                              d 
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-ag---g--pga-p-pgaltsqpesfptp-----------------------grrsppeepg-paadagda----l--ps
g--pvgagp---t-a--isa----r--e-sqprphrpsvsstptrlpsrrapa-a---dlaayllvapaaspsrv-qx-e
evsege-asvvhdelht-f-prgr-vsarrpigaegangpargppwlllapg-p-tts----s--------vrhftpvy-
deedainvleatavi qt-sceadehe-ieedp ra rl gssg   gsg  fxxrseppmeqthxtxqsyqqeegdixq
sd aysdpeasrslt pqmradxxxearx                       cvtmfdcxfxlxxrlsimgaevtysgsd
   qfd   lnee s entllasvtxxxl                       xsqxxxxwxtgvelxixxxhpssa air
    e    he   e sg ggcmgpprg                        nlnpewhardx  gpgvttfdpr  tr 
                fe ef  a n                          eghedma  cp   n  q   ai  rl 
                         a                           a        a           a     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
p-------------------------------------------------------------------------a-pavk
-gplgkrpavlpllevvqggsswprmvgslvstpppceesvnklyrqsvgqvsrymveyltgakdakplggsraplevah
ee             lfgeapngggldaffpfgaalaa eedeemeplleiiqewlraqaetrladwihssggwesrkil
v              p                                                           psrls
l              i                                                           mdp  
d              e                                                           aa   
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :.        .          .: :                 :       : ..  ::*  .  :   * .       
ltlreagdefqrryrrlfnemlsqlhmtp---------mtargrfetvveelfrdgV-nwGrivaffe--Fggvmcvesv
arvqrveedvsekleeaqagvskkmdlsnppgnagpvifsieesmaqdarsiyvgnptdy atatelsah haclsknlk
evm qmafg-agnhkt-lqplersfniks        veddvkklsa ivhv s   i    l elia   e fgaahrl
ra  d   s etqv kn sdctd   vv          g  yti nr mnke e           v v     ivt k  
  a      l f  d k  aa               d  qq  t  sd   q                   a      
                t                                                               
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    . .     :                                   :               
n------------------iemeslveslalwmteylnrhlrdwiq--------------pnggwdafvelygs------
tilcdkfsghpkgfayiefsdkspvrtnisedeslfrgtqikvipkrtnrpgisttdrgfdraryrtrttnfnptrlees
s                qrrnqdvcidpvqysiadvivdtkht lvqnggwengfvkkfekqr  lg laflhvsmaa a
e                  kssq dask  afvvt  t nmep  r              sks  ae   v  -na    
d                         gr      a  e r a   h              es           ng     
                           q                                             d      
                                                                                
                                                                                
                                                                                

       490       500       510       
....:....|....:....|....:....|....:..
                                     
---qrlfsgswsslrarlyrarv-gacstygay----
rkgspfydffnlrpkglvslglalrvtiwlsprlghk
   ed-eg------l-fagv-g- tgglawlilkqyy
   --r-- irnvv-w----m-  a vvmv h-fss 
   re rn n a   tv tg v    lelf -f ar 
       e             t         s     
                                     
                                     
                                     
© 1998-2022Legal notice