Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------r-lv-dfigyklsqkgyvwgaglgaas-gasa-gpr--asg-e--t---g-ggeaga--pgsagaa---
mmatprtaydn-e--m-yvnavir-rl-eg----aggapaggss-g-ll---r-rt-rre-t------vs---pa-sppt
 aqagasgpst amfglkrh----t--accdvss----g--a-pa-gifspqprappapargsswpartigav--v-   
 fhlk nsq    i ak---ln ylq  --m aqvsdvssn-tltqegtgfemgtnstvrvnrpplppqahvtnity   
  g   m        v vls   gcn  sl   pfe pep rreh amsea k shl ip hpdmhlegl lrl st   
                         g  g    e d  al dpa    r   d fe  fn af d   d   l  dg   
                                 d     e               a            a   g       
                                 a                                      a       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tlapdarrvarpspigaegpnvsatpprllllappcrasppeemegpaadaimspeeeldgyepeplgkrpavlpllelv
    qq ftqvsdelfqn lewgrlvaffvfgealpepevnk pprlvgqvqewmvay etrladwihssggw       
                gg   see e ee     e ae  e    p r p                              
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                             .  
----------------------------------------------------------akdakplggsvaa-rkvletlr
geassgpgmdgslpstpppaeeeedeepglvegdpgdgalyrqsleiisryvreqetg---lagpqnervpspvahqppg
        ap pg gsga gsq  e              iedpe  a karl  maeegekttedargpekqmnmspamq
                                                           hsssl tp  i mdplkl   
                                                           a g    l     aa      
                                                                  e             
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .*  .       :     .: :           :   ..  *  *.  ::     *           : .     :   
raGdgvqrryerafqgmlrqlhitnedavksfsrvvvhlfsdGv-NwgrivaffsfGafvc-vesvsiemeslveplaew
nv p-fsmnhrtkmselaskidvkpvtdrqrletlieevhrc st rvtlltlifs gvmafkhlknsnqspcitsiq-s
q   e itsi ed eddsas ylg gsyggtaaq ea gg pv      cdke  hplg ayiefrdkqvvrdnv l-
e   d el f  t aa t       f  ya  te sn               v   ak      dk      sr  a 
a                           q       d                                     gq    
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:   *      .:  .  .          *                              .     ..            
mteyLvrtlrdwivkqrgw--------dgFvelygvedlegg----------------ilsvllavagvatvgaglayk-
iddv nthkqtklqpngtnrpgisttdra prffhrtr----rkgqplfdfswlslranrnrar-fgafvglpryrvhli
lvts fdgrhi vidk           at taarypamttny   rrrrngn a vkwlstlsvfycnsr slfgsrg
 aa  e r ep  hss            e      nnaaaes    e  e       tv  gmt l  lil   f sr  
         a    e                    dg    a                f                     
                                                                                
                                                                                
                                                                                

       410 
....:....|.
           
r----------
-aratswyspy
           
           
           
           
           
           
© 1998-2022Legal notice