Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtqpgtrfwrgsmfglkrnavirtvlycisvpgwearlrdpeggaglgagsggasssggrllasgkeattdwrfslflpg
            ehsiradsakglqp v               strppp pq lpgtlmtnvsi r rkk          
                      akn                                                       
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--m---g-tgydnreivmk---yklsqrgyew------------------------------------------------
rr-aha-ra--------g-yph----------arpspigaegpnvsatpprllllptrrrsawkpsagpwesgrapptre
 legggfe-saviqgsa-dsipttfapvarrvfqrrskveq  rlpdfr gvtgq                   sw cpa
  asql tm wswgrnsvallsrr rkdntsi                                          lk    
   dpe gg qga qlpqef aq  pak fqf                                                
               c              m                                                 
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
s-geegagpvgaapappisesqpgshpeprgprp----------paasgspaatslps-rapg-----------------
dpp-amea-pvhtemsggftl-deyesaxlqksxavlpllelvghrspxpsrggraagtppgaprmtdelyrytlelisr
-deq----vaad-iicfeescrxxxxxxsaxxxs          eppxtagmdaaxxar--a-eeee cefgqs aiaqd
ma-lvsnve---n-- eatgggmvtpgtixvtpr          xxxtdxxxxxxvtxsss-s                 
 vsdkrd  lnr ly  qaafea rn g ssngd          wllra klvpp gthd tl                 
 f  fd   i l  t      c   g   nrh            mh a   drni   f  s                  
         e               f   elg            l        kg   a  r                  
                         a     a                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         .  .*. ..  .. .    :     .: :            *:   * *** ***
---------------pxpspvp-pvvhltLrrvgddvqrryrrafaemlsqlhltpf-targrfatVveelFrDGV-NWG
yvreqatgakhvlql-qxraasmrkalev qqaafgfsgnhet-lqgcsrkfdikneddvkts-sr ivhv s   t   
 l        dakpiggsg--- sr sra  d   s elqv kn kpltds  vvsv  dysllnq mnke e   i   
               da--vi  aa kq   e   e       d sd         g   vqi e               
                -re                                          k                  
                tl                                                              
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***:.: * . :         .       ::  ::  :      *: .: **:  **: :                    
RIVtffsFggvmcvesvnremsplvd--nialwmteylnRhlrdWiqdngGWd-gFVelygptm---------------l
   alie eafvakhl--ksinsescieplsesiadvivdtkht lvkqr  ena  kffhvedaaesrkgqplfdfsw-
    v a   ilt k leqrqqqdisa kyftf t nmep  rq      t   k en--        er n g  
          a     ksin evc e  r                e              ns                
                 d                                            ka                
                                                                                
                                                                                
                                                                                

       410       420         
....:....|....:....|....:....
          .       . :        
slkallslllvggvitlgaylghk-----
eggirnvwaafaacagvwsgmaylirqyy
-------gmtllt vltvclfwsyyk   
tfrwkst ev  e lem  h srhl    
    f g       c    e kq      
                             
                             
                             
© 1998-2020Legal notice