Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|E2QWA1_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL-2 (length=232 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISASQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
SPVPPVVHLTLRQAGDDFSRRYRRFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|E2QWA1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL-2 (length=193 residues).
PFQFGGCPVSFSGPELASPPPPPGPPAAAAAAAFPPRAPXXSPVPPVVHLTLRQAGDDFSRRYRRFAEMSSQLHLTPFTA
RGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTM
QPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|E2RS00_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2A1 (length=389 residues).
MTQPGTRFWRGSEHSIRADSAKAKVPYVISVPGWEARLRDPEGSTRPPPGPQGLPGTLMTNVSIGKERKKDWRFSLFLPG
RLADPEGTAGWGWQQNPQDLPAQRFRKVNTQIFQRRSKVEQGPRLPDFRPGVTGQPTRRRSAWKPSAGPWESGRSKPTPE
SDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGSSRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQ
PGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFEDGVINWGRIVTVFAFEGILTKKLLE
QRISSDVDAEKVSYFVAEFITRNMRDWIRQNGGWENGFVKKFEPKSGWLTFLEVLGTVCEMWSHLKQYY
>gnl|bcl2dbpro|E2RS00_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2A1 (length=262 residues).
MSHLFGGSYDAQRCSGERRLPAVGFMFLWPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGSSRGTRLP
SRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFN
QVMEKEFEDGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEFITRNMRDWIRQNGGWENGFVKKFEPKSG
WLTFLEVLGTVCEMWSHLKQYY
>gnl|bcl2dbpro|F1PAP1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Canis lupus familiaris GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|F1PAP1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Canis lupus familiaris GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGGGEAGAVIGGSAGASPPTTLAPDARRVARPS
PIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|Q6R755_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTG
PTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|Q75SV7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGIFSSQPGRAPAPARTSPPPPPAAPAAAAAAAAD
AAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|Q76LT7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q8HYS5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Canis lupus familiaris GN=MCL-1 (length=350 residues).
MFGLKRNAVIRTQLYCGGAGLGAGSGGASSSGGRLLASGREATTRREGGGGEAGAVIGGSAGASPPTTLAPDARRVARPS
PIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSRAASRKALETLQRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2020Legal notice