Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q45T69_BCL2L2-02        -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGP-AADPLHQAMRA
Q45T69_BCL2L2-03        ------------------------------MAAAAAAAAAAGAAGGRGSG
A0A5F4BWG4_MCL1-01      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLA
Q8HYS5_MCL1-01          -------------MFGLKRNAVIRTQLYCGGAGLGAGSGGASSSGGRLLA
A0A5F4BWG4_MCL1-02      MFGLKRNA---------VIGLNLYCGGAGLGAGSGGASSSGGR-------
Q45T69_BCL2L2-01        -MATPASAPDTRALVADFVGYKLRQKGYVC--------------------
Q76LT7_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSW--SQFSDVEENRTEAPEGTE
Q6R755_BCL2-01          MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFS
Q75SV7_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGIFS
                                                                          

Q45T69_BCL2L2-02        AGDEFETRFRRTFSDLAAQLHVTPGSA-------QQRFTQVSDELFQGGP
Q45T69_BCL2L2-03        PGRRRHL-VPGAGGEAGEGAPGGAGDY-------------------GNGL
A0A5F4BWG4_MCL1-01      SGKEATTRREGGGGEAGAVIGGSAGASPPTTLAPDARRVARPSPIGAEGP
Q8HYS5_MCL1-01          SGREATTRREGGGGEAGAVIGGSAGASPPTTLAPDARRVARPSPIGAEGP
A0A5F4BWG4_MCL1-02      ----------------------LLATG-----------------------
Q45T69_BCL2L2-01        --------------------------------------------------
Q76LT7_BCL2L1-01        SEMETPSAINGNPSWHLADSPAVNGAT-----------------------
Q6R755_BCL2-01          FQPESNPTPAVHRDMAARTSPLRPIVA-----------------------
Q75SV7_BCL2-01          SQPGRAPAPARTSPPPPPAAPAAAAAA-----------------------
                                                                          

Q45T69_BCL2L2-02        NWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSS
Q45T69_BCL2L2-03        ESEELEPEELLLEPEPEPEPEEEPPRPRAP--------------------
A0A5F4BWG4_MCL1-01      NVSATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKR
Q8HYS5_MCL1-01          NVSATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKR
A0A5F4BWG4_MCL1-02      --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
                                                                          

Q45T69_BCL2L2-02        GGW-----------------------------------------------
Q45T69_BCL2L2-03        ----------------PGAPGPGPGSGAPGSQEEEEEPGLVEGDPGDGAI
A0A5F4BWG4_MCL1-01      PAVLPLLELVGEASSGPGMDGSLPSTPPPAEEEEDE-------------L
Q8HYS5_MCL1-01          PAVLPLLELVGEASSGPGMDGSLPSTPPPAEEEEDE-------------L
A0A5F4BWG4_MCL1-02      --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
                                                                          

Q45T69_BCL2L2-02        ---ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP-VIMSI
Q45T69_BCL2L2-03        EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP-VIMSI
A0A5F4BWG4_MCL1-01      YRQSLEIISRYLREQATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNH
Q8HYS5_MCL1-01          YRQSLEIISRYLREQATGAKDAKPLGGSRAASRKALETLQRVGDGVQRNH
A0A5F4BWG4_MCL1-02      ------------------AKDAKPLGGSRAASRKALETLRRVGDGVQRNH
Q45T69_BCL2L2-01        ---------------------GAGPGEGPAA-DPLHQAMRAAGDEFETRF
Q76LT7_BCL2L1-01        ------------------GHSSSLDAREVIPMAAVKQALREAGDEFELRY
Q6R755_BCL2-01          ---------------------TTGPTLSPVP-PVVHLTLRRAGDDFSRRY
Q75SV7_BCL2-01          ------------------AADAAGPAPSPVP-PVVHLTLRQAGDDFSRRY
                                                             .   .*  .    

Q45T69_BCL2L2-02        EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
Q45T69_BCL2L2-03        EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
A0A5F4BWG4_MCL1-01      ETAFQGMLRKLDIKNEDDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFV
Q8HYS5_MCL1-01          ETAFQGMLRKLDIKNEDDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFV
A0A5F4BWG4_MCL1-02      ETAFQGMLRKLDIKNEDDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFV
Q45T69_BCL2L2-01        RRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP-NWGRLVAFFVFGAAL
Q76LT7_BCL2L1-01        RRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV-NWGRIVAFFSFGGAL
Q6R755_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGV-NWGRIVAFFEFGGVM
Q75SV7_BCL2-01          RRDFAEMSSQLHLTPFTARGRFATVVEELFRDGV-NWGRIVAFFEFGGVM
                           :     .: :           :   ..  *  *.  ::     *   

Q45T69_BCL2L2-02        GFAYIEFSDKESVRTSLA--LDESLFRGRQIKVIPKRTNRPGISTTDRGF
Q45T69_BCL2L2-03        GFAYIEFSDKESVRTSLA--LDESLFRGRQIKVIPKRTNRPGISTTDRGF
A0A5F4BWG4_MCL1-01      A-KHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW--------DGF
Q8HYS5_MCL1-01          A-KHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW--------DGF
A0A5F4BWG4_MCL1-02      A-KHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW--------DGF
Q45T69_BCL2L2-01        C-AESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW--------AEF
Q76LT7_BCL2L1-01        C-VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW--------DTF
Q6R755_BCL2-01          C-VESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGW--------DAF
Q75SV7_BCL2-01          C-VESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGW--------DAF
                                : .     :   :   *      .:  .  .          *

Q45T69_BCL2L2-02        PRARYRARTTNY----------------NSSRSRFYSGFNSRPRGRVYRG
Q45T69_BCL2L2-03        PRARYRARTTNY----------------NSSRSRFYSGFNSRPRGRVYRG
A0A5F4BWG4_MCL1-01      VEFFHVEDLEGG----------------IRNVLLAFAGVAGVGAGLAYLI
Q8HYS5_MCL1-01          VEFFHVEDLEGG----------------IRNVLLAFAGVAGVGAGLAYLI
A0A5F4BWG4_MCL1-02      VEFFHVEDLEGG----------------IRNVLLAFAGVAGVGAGLAYLI
Q45T69_BCL2L2-01        TALYGDGALEEA---RRLREGNWASVRTVLTGAVALGALVTVGAFFASK-
Q76LT7_BCL2L1-01        VELYGNNAAAESRKGQERFN------RWFLTGMT-VAGVVLLGSLFSRK-
Q6R755_BCL2-01          VELYGPTM-------QPLFDFSWLSLKALLSLAL-VGACITLGAYLGHK-
Q75SV7_BCL2-01          VELYGPTM-------QPLFDFSWLSLKALLSLAL-VGACITLGAYLGHK-
                                                      .     ..            

Q45T69_BCL2L2-02        RARATSWYSPY
Q45T69_BCL2L2-03        RARATSWYSPY
A0A5F4BWG4_MCL1-01      R----------
Q8HYS5_MCL1-01          R----------
A0A5F4BWG4_MCL1-02      R----------
Q45T69_BCL2L2-01        -----------
Q76LT7_BCL2L1-01        -----------
Q6R755_BCL2-01          -----------
Q75SV7_BCL2-01          -----------
                                   

© 1998-2022Legal notice