Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F4CJR7_BCL2A1-      MTQPGTRFWRGSEHSIRADSAKAKVPYVISVPGWEARLRDPEGSTRPPPG
A0A5F4CJR7_BCL2A1-      ----------------------------------MSHLFGGSYDAQRCSG
A0A5F4BWG4_MCL1-02      -------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGASSS
A0A5F4BWG4_MCL1-01      -------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGASSS
Q8HYS5_MCL1-01          -------------------MFGLKRNAVIRTQLYCGGAGLGAGSGGASSS
Q45T69_BCL2L2-01        -----------------------------------------MATPASAPD
Q45T69_BCL2L2-03        -----------------------------------------MATPASAPD
Q45T69_BCL2L2-02        -----------------------------------------MATPASAPD
Q45T69_BCL2L2-04        -----------------------------MAGSLAVRCGARFTC------
Q45T69_BCL2L2-05        -----------------------------MAAAAAAAAAAGAAGGRGSGP
Q76LT7_BCL2L1-01        ----------------------------------------------MSQS
E2QWA1_BCL2-02          ----------------------------------------MAHAGRTGYD
Q6R755_BCL2-01          ----------------------------------------MAQAGRTGYD
E2QWA1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          ----------------------------------------MAHAGRTGYD
                                                                          

A0A5F4CJR7_BCL2A1-      PQGLPGTLMTNVSIGKERKKDWRFSLFLPGRLADPEGTAGWGWQQNPQDL
A0A5F4CJR7_BCL2A1-      ERRLPAVGFMFLW-------------------------------------
A0A5F4BWG4_MCL1-02      GGRLLAT-------------------------------------------
A0A5F4BWG4_MCL1-01      GGRLLASGKEATT-------------------------------------
Q8HYS5_MCL1-01          GGRLLASGREATT-------------------------------------
Q45T69_BCL2L2-01        TRALVADFVGYKL-------------------------------------
Q45T69_BCL2L2-03        TRALVADFVGYKL-------------------------------------
Q45T69_BCL2L2-02        TRALVADFVGYKL-------------------------------------
Q45T69_BCL2L2-04        --------------------------------------------------
Q45T69_BCL2L2-05        GRRRHLVPGAGGE-------------------------------------
Q76LT7_BCL2L1-01        NRELVVDFLSYKL-------------------------------------
E2QWA1_BCL2-02          NREIVMKYIHYKL-------------------------------------
Q6R755_BCL2-01          NREIVMKYIHYKL-------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          NREIVMKYIHYKL-------------------------------------
                                                                          

A0A5F4CJR7_BCL2A1-      PAQRFRKVNTQIFQRRSKVEQGPRLPDFRPGVTGQPTRRRSAWKPSAGPW
A0A5F4CJR7_BCL2A1-      --------------------------------------------------
A0A5F4BWG4_MCL1-02      --------------------------------------------------
A0A5F4BWG4_MCL1-01      --------------------------------------------------
Q8HYS5_MCL1-01          --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-03        --------------------------------------------------
Q45T69_BCL2L2-02        --------------------------------------------------
Q45T69_BCL2L2-04        --------------------------------------------------
Q45T69_BCL2L2-05        --------------------------------------------------
Q76LT7_BCL2L1-01        --------------------------------------------------
E2QWA1_BCL2-02          --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
E2QWA1_BCL2-01          --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
                                                                          

A0A5F4CJR7_BCL2A1-      ESGRSKPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGS
A0A5F4CJR7_BCL2A1-      ---PTPESDEEEG---AGPVVHTEIPPASTCRPESHPEPRQPRPHRASGS
A0A5F4BWG4_MCL1-02      --------------------------------------------------
A0A5F4BWG4_MCL1-01      ---RREGGGGEAGAVIGGSAGASP-PTTLAPDARRVARPSPIGAEGPNVS
Q8HYS5_MCL1-01          ---RREGGGGEAGAVIGGSAGASP-PTTLAPDARRVARPSPIGAEGPNVS
Q45T69_BCL2L2-01        ---RQKGYVCGAGPGEGP--------------------------------
Q45T69_BCL2L2-03        ---RQKGYVCGAGPGEG--PAADPLHQAMRAAGDEFETR-----------
Q45T69_BCL2L2-02        ---RQKGYVCGAGPGEG--PAADPLHQAMRAAGDEFETR-----------
Q45T69_BCL2L2-04        -------------------HETDVSPSNLTSQSASERAI-----------
Q45T69_BCL2L2-05        ---AGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPELEEDPPRAPRLP
Q76LT7_BCL2L1-01        ---SQKGYSW--SQFSDVEENRTEAPEGTESEMETPSAI-----------
E2QWA1_BCL2-02          ---SQRGYEWDAGEAGAAPPGAAPAPGISASQXXXXXXX-----------
Q6R755_BCL2-01          ---SQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTP-----------
E2QWA1_BCL2-01          -------------------------PFQFGGCPVSFSGP-----------
Q75SV7_BCL2-01          ---SQRGYEWDAGEAGAAPPGAAPAPGIFSSQPGRAPAP-----------
                                                                          

A0A5F4CJR7_BCL2A1-      SRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGP-------
A0A5F4CJR7_BCL2A1-      SRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGP-------
A0A5F4BWG4_MCL1-02      --------------------------------------------------
A0A5F4BWG4_MCL1-01      ATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAV
Q8HYS5_MCL1-01          ATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAV
Q45T69_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-03        ------------FRRTFSDLAAQLHVTPGSAQQRFTQVSDE---------
Q45T69_BCL2L2-02        ------------FRRTFSDLAAQLHVTPGSAQQRFTQVSDE---------
Q45T69_BCL2L2-04        ------------AARRSEDWPCLLALASGQSPSVIYSRIRL---------
Q45T69_BCL2L2-05        GSSGPWPGSGAPGSQEEEEEPGLVEGDPGDGA------IED---------
Q76LT7_BCL2L1-01        ------------NGNPSWHLADSPAVNGATGHSSSLDAREV---------
E2QWA1_BCL2-02          ------------XXXXXXXXXXXXXXXXXXX------XXSP---------
Q6R755_BCL2-01          ------------AVHRDMAARTSPLRPIVAT---TGPTLSP---------
E2QWA1_BCL2-01          ------------ELASPPPPPGPPAAAAAAAFPPRAPXXSP---------
Q75SV7_BCL2-01          ------------ARTSPPPPPAAPAAAAAAAADAAGPAPSP---------
                                                                          

A0A5F4CJR7_BCL2A1-      --------------------------------------------------
A0A5F4CJR7_BCL2A1-      --------------------------------------------------
A0A5F4BWG4_MCL1-02      --------------------------------------------------
A0A5F4BWG4_MCL1-01      LPLLELVGEASSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQA
Q8HYS5_MCL1-01          LPLLELVGEASSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQA
Q45T69_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-03        -----LFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYL
Q45T69_BCL2L2-02        -----LFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYL
Q45T69_BCL2L2-04        -----E--------------------------------------------
Q45T69_BCL2L2-05        -----P--------------------------------------------
Q76LT7_BCL2L1-01        -----I--------------------------------------------
E2QWA1_BCL2-02          -----V--------------------------------------------
Q6R755_BCL2-01          -----V--------------------------------------------
E2QWA1_BCL2-01          -----V--------------------------------------------
Q75SV7_BCL2-01          -----V--------------------------------------------
                                                                          

A0A5F4CJR7_BCL2A1-      --------------APSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVS-
A0A5F4CJR7_BCL2A1-      --------------APSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVS-
A0A5F4BWG4_MCL1-02      -GAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-
A0A5F4BWG4_MCL1-01      TGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-
Q8HYS5_MCL1-01          TGAKDAKPLGGSRAASRKALETLQRVGDGVQRNHETAFQGMLRKLDIKN-
Q45T69_BCL2L2-01        --------------AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-
Q45T69_BCL2L2-03        ETRLADWIHSSGGWELEAIKARVREMEEE-AEKLKELQNEVEKQMNMSPP
Q45T69_BCL2L2-02        ETRLADWIHSSGGWELEAIKARVREMEEE-AEKLKELQNEVEKQMNMSPP
Q45T69_BCL2L2-04        --------------ELEAIKARVREMEEE-AEKLKELQNEVEKQMNMSPP
Q45T69_BCL2L2-05        --------------ELEAIKARVREMEEE-AEKLKELQNEVEKQMNMSPP
Q76LT7_BCL2L1-01        --------------PMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-
E2QWA1_BCL2-02          --------------P-PVVHLTLRQAGDDFSRRYRR-FAEMSSQLHLTP-
Q6R755_BCL2-01          --------------P-PVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP-
E2QWA1_BCL2-01          --------------P-PVVHLTLRQAGDDFSRRYRR-FAEMSSQLHLTP-
Q75SV7_BCL2-01          --------------P-PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-
                                              :.        .          .: :   

A0A5F4CJR7_BCL2A1-      -------VDTARTIFNQVMEKEFEDGVINWGRIVTVFA--FEGILTKKLL
A0A5F4CJR7_BCL2A1-      -------VDTARTIFNQVMEKEFEDGVINWGRIVTVFA--FEGILTKKLL
A0A5F4BWG4_MCL1-02      --------EDDVKSLSRVIVHVFSDGVTNWGRIVTLIS--FGAFVAKHLK
A0A5F4BWG4_MCL1-01      --------EDDVKSLSRVIVHVFSDGVTNWGRIVTLIS--FGAFVAKHLK
Q8HYS5_MCL1-01          --------EDDVKSLSRVIVHVFSDGVTNWGRIVTLIS--FGAFVAKHLK
Q45T69_BCL2L2-01        --------GSAQQRFTQVSDELFQGGP-NWGRLVAFFV--FGAALCAESV
Q45T69_BCL2L2-03        PGNAGPVIMSIEEKMEADARSIYVGNV-DYGATAEELEAHFHGCGSVNRV
Q45T69_BCL2L2-02        PGNAGPVIMSIEEKMEADARSIYVGNV-DYGATAEELEAHFHGCGSVNRV
Q45T69_BCL2L2-04        PGNAGPVIMSIEEKMEADARSIYVGNV-DYGATAEELEAHFHGCGSVNRV
Q45T69_BCL2L2-05        PGNAGPVIMSIEEKMEADARSIYVGNV-DYGATAEELEAHFHGCGSVNRV
Q76LT7_BCL2L1-01        --------GTAYQSFEQVVNELFRDGV-NWGRIVAFFS--FGGALCVESV
E2QWA1_BCL2-02          --------FTARGRFATVVEELFRDGV-NWGRIVAFFE--FGGVMCVESV
Q6R755_BCL2-01          --------FTARGRFATVVEELFRDGV-NWGRIVAFFE--FGGVMCVESV
E2QWA1_BCL2-01          --------FTARGRFATVVEELFRDGV-NWGRIVAFFE--FGGVMCVESV
Q75SV7_BCL2-01          --------FTARGRFATVVEELFRDGV-NWGRIVAFFE--FGGVMCVESV
                                      :       : ..  ::*  .  :   * .       

A0A5F4CJR7_BCL2A1-      E----------------QRISSDVDAEKVSYFVAEFITRNMRDWIRQNGG
A0A5F4CJR7_BCL2A1-      E----------------QRISSDVDAEKVSYFVAEFITRNMRDWIRQNGG
A0A5F4BWG4_MCL1-02      S------------------INQESCIEPLAESITDVLVRTKRDWLV----
A0A5F4BWG4_MCL1-01      S------------------INQESCIEPLAESITDVLVRTKRDWLV----
Q8HYS5_MCL1-01          S------------------INQESCIEPLAESITDVLVRTKRDWLV----
Q45T69_BCL2L2-01        N------------------KEMEPLVGQVQEWMVAYLETRLADWIH----
Q45T69_BCL2L2-03        TILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNR
Q45T69_BCL2L2-02        TILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNR
Q45T69_BCL2L2-04        TILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNR
Q45T69_BCL2L2-05        TILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNR
Q76LT7_BCL2L1-01        D------------------KEMQVLVSRIAAWMATYLNDHLEPWIQ----
E2QWA1_BCL2-02          N------------------REMSPLVDNIALWMTEYLNRHLHTWIQ----
Q6R755_BCL2-01          N------------------REMSPLVDNIALWMTEYLNRHLHTWIQ----
E2QWA1_BCL2-01          N------------------REMSPLVDNIALWMTEYLNRHLHTWIQ----
Q75SV7_BCL2-01          N------------------REMSPLVDNIALWMTEYLNRHLHTWIQ----
                                            . .     :                     

A0A5F4CJR7_BCL2A1-      WENGFVKKFEPKSGWLTFLEVLG---------------------------
A0A5F4CJR7_BCL2A1-      WENGFVKKFEPKSGWLTFLEVLG---------------------------
A0A5F4BWG4_MCL1-02      ----------KQRGWDGFVEFFHV---------EDLEGGIRNVLLAFAGV
A0A5F4BWG4_MCL1-01      ----------KQRGWDGFVEFFHV---------EDLEGGIRNVLLAFAGV
Q8HYS5_MCL1-01          ----------KQRGWDGFVEFFHV---------EDLEGGIRNVLLAFAGV
Q45T69_BCL2L2-01        ----------SSGGWAEFTALYGDGALEEA---RRLREGNWASVRTVLTG
Q45T69_BCL2L2-03        PGISTTDRGFPRARYRARTTNYNSSR-------SRFYSGFNSRPRGRVYR
Q45T69_BCL2L2-02        PGISTTDRGFPRARYRARTTNYNSSR-------SRFYSGFNSRPRGRVYR
Q45T69_BCL2L2-04        PGISTTDRGFPRARYRARTTNYNSSR-------SRFYSGFNSRPRGRVYR
Q45T69_BCL2L2-05        PGISTTDRGFPRARYRARTTNYNSSR-------SRFYSGFNSRPRGRVYR
Q76LT7_BCL2L1-01        ----------ENGGWDTFVELYGNNAAAESRKGQERFN------RWFLTG
E2QWA1_BCL2-02          ----------DNGGWDAFVELYGPTM-------QPLFDFSWLSLKALLSL
Q6R755_BCL2-01          ----------DNGGWDAFVELYGPTM-------QPLFDFSWLSLKALLSL
E2QWA1_BCL2-01          ----------DNGGWDAFVELYGPTM-------QPLFDFSWLSLKALLSL
Q75SV7_BCL2-01          ----------DNGGWDAFVELYGPTM-------QPLFDFSWLSLKALLSL
                                      :                                   

A0A5F4CJR7_BCL2A1-      ----TVCEMWSHLKQYY
A0A5F4CJR7_BCL2A1-      ----TVCEMWSHLKQYY
A0A5F4BWG4_MCL1-02      AGV-GAGLAYLIR----
A0A5F4BWG4_MCL1-01      AGV-GAGLAYLIR----
Q8HYS5_MCL1-01          AGV-GAGLAYLIR----
Q45T69_BCL2L2-01        AVALGALVTVGAFFASK
Q45T69_BCL2L2-03        GRA-RATSWYSPY----
Q45T69_BCL2L2-02        GRA-RATSWFL------
Q45T69_BCL2L2-04        GRA-RATSWYSPY----
Q45T69_BCL2L2-05        GRA-RATSWYSPY----
Q76LT7_BCL2L1-01        MTV-AGVVLLGSLFSRK
E2QWA1_BCL2-02          ALV-GACITLGAYLGHK
Q6R755_BCL2-01          ALV-GACITLGAYLGHK
E2QWA1_BCL2-01          ALV-GACITLGAYLGHK
Q75SV7_BCL2-01          ALV-GACITLGAYLGHK
                                         

© 1998-2021Legal notice