Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0Q365_BCL2A1-      MSHLFGGSYDAQRCSGERRLPAVGFMFLWPTPESDEEEGAGPVVHTEIPP
A0A8C0Q365_BCL2A1-      MCPL---GRRGRKTGVSPSFCLVGWLTLKPTPESDEEEGAGPVVHTEIPP
Q75SV7_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLS---QRGYEWDAGEAGAAPPGAAPAPG
A0A8C0RVL3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLS---QRGYEWDAGEAGAAPPGAAPAPG
Q6R755_BCL2-01          MAQAGRTGYDNREIVMKYIHYKLS---QRGYEWDVGDVDAAPLGAAPTPG
A0A8C0S8A7_MCL1-02      -------------MFGLKRNAVIG---LNLYCGGAG-LGAGSGGASSSGG
Q45T69_BCL2L2-03        -MATPASAPDTRALVADFVGYKLR---QKGYVCGAG-PGEGP-AADPLHQ
Q45T69_BCL2L2-01        -MATPASAPDTRALVADFVGYKLR---QKGYVCGAG-PGEGP-AADPLHQ
Q45T69_BCL2L2-02        ---------------------------------MAA-AAAAAAAAGAAGG
A0A8C0S8A7_MCL1-01      -------------MFGLKRNAVIG---LNLYCGGAG-LGAGSGGASSSGG
Q8HYS5_MCL1-01          -------------MFGLKRNAVIR---TQLYCGGAG-LGAGSGGASSSGG
                                                                ..        

A0A8C0Q365_BCL2A1-      ASTCRPESHPEPRQPRPHRASGSSRGTRLPSRRAGGPRMTDCEFGYTLAL
A0A8C0Q365_BCL2A1-      ASTCRPESHPEPRQPRPHRASGSSRGTRLPSRRAGGPRMTDCEFGYTLAL
Q75SV7_BCL2-01          IFSSQPGRAPAPARTSPPPPPAAPAAAAAAAADAAG--------------
A0A8C0RVL3_BCL2-01      ISASQPGRAPAPARTSPPPPPAAPAAAAAA---AAG--------------
Q6R755_BCL2-01          IFSFQPESNPTPAVHRDMAARTSPLRPIVA---TTG--------------
A0A8C0S8A7_MCL1-02      --------------------------------------------------
Q45T69_BCL2L2-03        --------------------------------------------------
Q45T69_BCL2L2-01        --------------------------------------------------
Q45T69_BCL2L2-02        --------------------------------------------------
A0A8C0S8A7_MCL1-01      --------------------------------------------------
Q8HYS5_MCL1-01          --------------------------------------------------
                                                                          

A0A8C0Q365_BCL2A1-      AQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVV
A0A8C0Q365_BCL2A1-      AQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVV
Q75SV7_BCL2-01          -----------PAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT
A0A8C0RVL3_BCL2-01      -----------PAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT
Q6R755_BCL2-01          -----------PTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLT
A0A8C0S8A7_MCL1-02      -----------------------RLLATG---------------------
Q45T69_BCL2L2-03        -----------------------AMRAAGDEFETRFRRTFSDLAAQLHVT
Q45T69_BCL2L2-01        -----------------------AMRAAGDEFETRFRRTFSDLAAQLHVT
Q45T69_BCL2L2-02        -----------------------RGSGPGRRRHL-VPGAGGEAGEGAPGG
A0A8C0S8A7_MCL1-01      -----------------------RLLASGKEATTRREGGGGEAGAVIGGS
Q8HYS5_MCL1-01          -----------------------RLLASGREATTRREGGGGEAGAVIGGS
                                                    .                     

A0A8C0Q365_BCL2A1-      SVDT------ARTIFNQVMEKEFEDGVINWGRIVTVFAFEGILTKKLLEQ
A0A8C0Q365_BCL2A1-      SVDT------ARTIFNQVMEKEFEDGVINWGRIVTVFAFEGILTKKLLEQ
Q75SV7_BCL2-01          PFTA-------RGRFATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNR
A0A8C0RVL3_BCL2-01      PFTA-------RGRFATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNR
Q6R755_BCL2-01          PFTA-------RGRFATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNR
A0A8C0S8A7_MCL1-02      --------------------------------------------------
Q45T69_BCL2L2-03        PGSA-------QQRFTQVSDELFQGGP-NWGRLVAFFVFGAALCAESVNK
Q45T69_BCL2L2-01        PGSA-------QQRFTQVSDELFQGGP-NWGRLVAFFVFGAALCAESVNK
Q45T69_BCL2L2-02        AGDY-------------------GNGL-ESEELEPEELLLEPEPEPEPEE
A0A8C0S8A7_MCL1-01      AGASPPTTLAPDARRVARPSPIGAEGP-NVSATPPRLLLLAPPCRASPPE
Q8HYS5_MCL1-01          AGASPPTTLAPDARRVARPSPIGAEGP-NVSATPPRLLLLAPPCRASPPE
                                                                          

A0A8C0Q365_BCL2A1-      RISSDVDAEKVSYFVAEFITRNMRDWIRQNGGWEN---------------
A0A8C0Q365_BCL2A1-      RISSDVDAEKVSYFVAEFITRNMRDWIRQNGGWEN---------------
Q75SV7_BCL2-01          EMSPLVD--NIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP--------
A0A8C0RVL3_BCL2-01      EMSPLVD--NIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP--------
Q6R755_BCL2-01          EMSPLVD--NIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP--------
A0A8C0S8A7_MCL1-02      --------------------------------------------------
Q45T69_BCL2L2-03        EMEPLVG--QVQEWMVAYLETRLADWIHSSGGWAEFTALYGD--------
Q45T69_BCL2L2-01        EMEPLVG--QVQEWMVAYLETRLADWIHSSGGW-----------------
Q45T69_BCL2L2-02        EPPRPRA--P------------------------------------PGAP
A0A8C0S8A7_MCL1-01      EMEGPAA--DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMD
Q8HYS5_MCL1-01          EMEGPAA--DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMD
                                                                          

A0A8C0Q365_BCL2A1-      --------------------------------------------------
A0A8C0Q365_BCL2A1-      --------------------------------------------------
Q75SV7_BCL2-01          --------------------------------------------------
A0A8C0RVL3_BCL2-01      --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
A0A8C0S8A7_MCL1-02      ------------------------------------------------AK
Q45T69_BCL2L2-03        --------------------------------------------------
Q45T69_BCL2L2-01        ---------------------------------ELEAIKARVREMEEEAE
Q45T69_BCL2L2-02        GPGPGSGAPGSQEEEEEPGLVEGDPGDGAIEDPELEAIKARVREMEEEAE
A0A8C0S8A7_MCL1-01      GSLPSTPPPAEEEEDE-------------LYRQSLEIISRYLREQATGAK
Q8HYS5_MCL1-01          GSLPSTPPPAEEEEDE-------------LYRQSLEIISRYLREQATGAK
                                                                          

A0A8C0Q365_BCL2A1-      --------------------------------------------------
A0A8C0Q365_BCL2A1-      --------------------------------------------------
Q75SV7_BCL2-01          TMQPLFDFSWLSLKALLSLALVGACITL----------------------
A0A8C0RVL3_BCL2-01      TMQPLFDFSWLSLKALLSLALVGACITL----------------------
Q6R755_BCL2-01          TMQPLFDFSWLSLKALLSLALVGACITL----------------------
A0A8C0S8A7_MCL1-02      DAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVK
Q45T69_BCL2L2-03        --------------------------------------------------
Q45T69_BCL2L2-01        KLKELQNEVEKQMNMSPPPGNAGP-VIMSIEEKMEADARSIYVGNVDYGA
Q45T69_BCL2L2-02        KLKELQNEVEKQMNMSPPPGNAGP-VIMSIEEKMEADARSIYVGNVDYGA
A0A8C0S8A7_MCL1-01      DAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVK
Q8HYS5_MCL1-01          DAKPLGGSRAASRKALETLQRVGDGVQRNHETAFQGMLRKLDIKNEDDVK
                                                                          

A0A8C0Q365_BCL2A1-      --------------------------GFVKKFE-----------------
A0A8C0Q365_BCL2A1-      --------------------------GFVKKFE-----------------
Q75SV7_BCL2-01          --------------------------GAYLGHK-----------------
A0A8C0RVL3_BCL2-01      --------------------------GAYLGHK-----------------
Q6R755_BCL2-01          --------------------------GAYLGHK-----------------
A0A8C0S8A7_MCL1-02      SLSRVIVHVFSDGVTNWGRIVTLISFGAFVA-KHLKSINQESCIEPLAES
Q45T69_BCL2L2-03        --------------------------GALEEARRLREGNWASVRTVLTGA
Q45T69_BCL2L2-01        TAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLA--
Q45T69_BCL2L2-02        TAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLA--
A0A8C0S8A7_MCL1-01      SLSRVIVHVFSDGVTNWGRIVTLISFGAFVA-KHLKSINQESCIEPLAES
Q8HYS5_MCL1-01          SLSRVIVHVFSDGVTNWGRIVTLISFGAFVA-KHLKSINQESCIEPLAES
                                                  *                       

A0A8C0Q365_BCL2A1-      -------------------------PKSGWLTFLEVLGTVCEMWSHLKQY
A0A8C0Q365_BCL2A1-      -------------------------PKSGWLTFLEVLGTVCEMWSHLKQY
Q75SV7_BCL2-01          --------------------------------------------------
A0A8C0RVL3_BCL2-01      --------------------------------------------------
Q6R755_BCL2-01          --------------------------------------------------
A0A8C0S8A7_MCL1-02      ITDVLVRTKRDWLVKQRGW--------DGFVEFFHVEDLEGGIRNVLLAF
Q45T69_BCL2L2-03        VALGAL--------------------------------------------
Q45T69_BCL2L2-01        LDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFY
Q45T69_BCL2L2-02        LDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFY
A0A8C0S8A7_MCL1-01      ITDVLVRTKRDWLVKQRGW--------DGFVEFFHVEDLEGGIRNVLLAF
Q8HYS5_MCL1-01          ITDVLVRTKRDWLVKQRGW--------DGFVEFFHVEDLEGGIRNVLLAF
                                                                          

A0A8C0Q365_BCL2A1-      Y------------------------
A0A8C0Q365_BCL2A1-      Y------------------------
Q75SV7_BCL2-01          -------------------------
A0A8C0RVL3_BCL2-01      -------------------------
Q6R755_BCL2-01          -------------------------
A0A8C0S8A7_MCL1-02      AGVAGVGAGLAYLIR----------
Q45T69_BCL2L2-03        -----VTVGAFFASK----------
Q45T69_BCL2L2-01        SGFNSRPRGRVYRGRARATSWYSPY
Q45T69_BCL2L2-02        SGFNSRPRGRVYRGRARATSWYSPY
A0A8C0S8A7_MCL1-01      AGVAGVGAGLAYLIR----------
Q8HYS5_MCL1-01          AGVAGVGAGLAYLIR----------
                                                 

© 1998-2022Legal notice