Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1PAP1_MCL1-02        --------------------------------------------------
E2RS00_BCL2A1-02      --------------------------------------------------
Q76LT7_BCL2L1-01      --------------------------------------------------
E2QWA1_BCL2-02        --------------------------------------------------
Q6R755_BCL2-01        --------------------------------------------------
E2QWA1_BCL2-01        --------------------------------------------------
Q75SV7_BCL2-01        --------------------------------------------------
E2RS00_BCL2A1-01      MTQPGTRFWRGSEHSIRADSAKAKVPYVISVPGWEARLRDPEGSTRPPPG
F1PAP1_MCL1-01        ------------MFGLKRNAVIGLNLYC--------------GGAGLGAG
Q8HYS5_MCL1-01        ------------MFGLKRNAVIRTQLYC--------------GGAGLGAG
                                                                        

F1PAP1_MCL1-02        --------------------------------------------------
E2RS00_BCL2A1-02      --------------------------------MSHLFGGSYDAQRCSGE-
Q76LT7_BCL2L1-01      --------------------------------------MSQSNRELVVDF
E2QWA1_BCL2-02        --------------------------------MAHAGRTGYDNREIVMKY
Q6R755_BCL2-01        --------------------------------MAQAGRTGYDNREIVMKY
E2QWA1_BCL2-01        --------------------------------------------------
Q75SV7_BCL2-01        --------------------------------MAHAGRTGYDNREIVMKY
E2RS00_BCL2A1-01      PQGLPGTLMTNVSIGKERKKDWRFSLFLPGRLADPEGTAGWGWQQNPQDL
F1PAP1_MCL1-01        SGGASSSGGRLLASGKEATT----------RREGGGGEAGAVIGGSAGAS
Q8HYS5_MCL1-01        SGGASSSGGRLLASGREATT----------RREGGGGEAGAVIGGSAGAS
                                                                        

F1PAP1_MCL1-02        --------------------------------------------------
E2RS00_BCL2A1-02      --RRLPAVGFMF--------------------------------------
Q76LT7_BCL2L1-01      LSYKLSQKGYSW--------------------------------------
E2QWA1_BCL2-02        IHYKLSQRGYEW--------------------------------------
Q6R755_BCL2-01        IHYKLSQRGYEW--------------------------------------
E2QWA1_BCL2-01        --------------------------------------------------
Q75SV7_BCL2-01        IHYKLSQRGYEW--------------------------------------
E2RS00_BCL2A1-01      PAQRFRKVNTQIFQRRSKVEQGPRLPDFRPGVTGQPTRRRSAWKPSAGPW
F1PAP1_MCL1-01        PPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLL---------------
Q8HYS5_MCL1-01        PPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLL---------------
                                                                        

F1PAP1_MCL1-02        ----------MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGR------
E2RS00_BCL2A1-02      ----LWPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRP------
Q76LT7_BCL2L1-01      ------------SQFSDVEENRTEAPEGTESEMETPSAINGNPS------
E2QWA1_BCL2-02        ----------DAGEAGAAPPGAAPAPGISASQXXXXXXXXXXXX------
Q6R755_BCL2-01        ----------DVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRD------
E2QWA1_BCL2-01        -------------------------PFQFGGCPVSFSGPELASP------
Q75SV7_BCL2-01        ----------DAGEAGAAPPGAAPAPGIFSSQPGRAPAPARTSP------
E2RS00_BCL2A1-01      ESGRSKPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRP------
F1PAP1_MCL1-01        ----APPCRASPPEEMEGPAADAIMSPEEEL-DGYEPEPLGKRPAVLPLL
Q8HYS5_MCL1-01        ----APPCRASPPEEMEGPAADAIMSPEEEL-DGYEPEPLGKRPAVLPLL
                                                                        

F1PAP1_MCL1-02        ----LLATGAKDAKPLGGSRAAS---------------------------
E2RS00_BCL2A1-02      ----HRASGSSRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVR-------
Q76LT7_BCL2L1-01      ----WHLADSPAVNGATGHSSSL---------------------------
E2QWA1_BCL2-02        ----XXXXXXXXXXXXXX--------------------------------
Q6R755_BCL2-01        ----MAARTSPLRPIVAT---TG---------------------------
E2QWA1_BCL2-01        ----PPPPGPPAAAAAAAFPPRA---------------------------
Q75SV7_BCL2-01        ----PPPPAAPAAAAAAAADAAG---------------------------
E2RS00_BCL2A1-01      ----HRASGSSRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVR-------
F1PAP1_MCL1-01        ELVGEASSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAK
Q8HYS5_MCL1-01        ELVGEASSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAK
                                                                        

F1PAP1_MCL1-02        -------------RKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE-DD
E2RS00_BCL2A1-02      HVLQIPQPGPAP-SRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTA
Q76LT7_BCL2L1-01      -----DAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPG-TA
E2QWA1_BCL2-02        ------XXSPVP-PVVHLTLRQAGDDFSRRYRR-FAEMSSQLHLTPF-TA
Q6R755_BCL2-01        -----PTLSPVP-PVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPF-TA
E2QWA1_BCL2-01        -----PXXSPVP-PVVHLTLRQAGDDFSRRYRR-FAEMSSQLHLTPF-TA
Q75SV7_BCL2-01        -----PAPSPVP-PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF-TA
E2RS00_BCL2A1-01      HVLQIPQPGPAP-SRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTA
F1PAP1_MCL1-01        DAKPLGGSRAAS-RKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDV
Q8HYS5_MCL1-01        DAKPLGGSRAAS-RKALETLQRVGDGVQRNHETAFQGMLRKLDIKNEDDV
                                     .  .*. ..  .. .    :     .: :      

F1PAP1_MCL1-02        VKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE--PL
E2RS00_BCL2A1-02      RTIFNQVMEKEFEDGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKV
Q76LT7_BCL2L1-01      YQSFEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--RI
E2QWA1_BCL2-02        RGRFATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--NI
Q6R755_BCL2-01        RGRFATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--NI
E2QWA1_BCL2-01        RGRFATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--NI
Q75SV7_BCL2-01        RGRFATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--NI
E2RS00_BCL2A1-01      RTIFNQVMEKEFEDGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKV
F1PAP1_MCL1-01        KSL-SRVIVHVFSDGVTNWGRIVTLISFGAFVAKHL--KSINQESCIEPL
Q8HYS5_MCL1-01        KSL-SRVIVHVFSDGVTNWGRIVTLISFGAFVAKHL--KSINQESCIEPL
                            *:   * *** ******:.: * . :         .       :

F1PAP1_MCL1-02        AESITDVLVRTKRDWLVKQRGWD-GFVEFFHVED---------------L
E2RS00_BCL2A1-02      SYFVAEFITRNMRDWIRQNGGWENGFVKKFEPKS-------------GWL
Q76LT7_BCL2L1-01      AAWMATYLNDHLEPWIQENGGWD-TFVELYGNNAAAESRKGQERFN----
E2QWA1_BCL2-02        ALWMTEYLNRHLHTWIQDNGGWD-AFVELYGPTM-------QPLFDFSWL
Q6R755_BCL2-01        ALWMTEYLNRHLHTWIQDNGGWD-AFVELYGPTM-------QPLFDFSWL
E2QWA1_BCL2-01        ALWMTEYLNRHLHTWIQDNGGWD-AFVELYGPTM-------QPLFDFSWL
Q75SV7_BCL2-01        ALWMTEYLNRHLHTWIQDNGGWD-AFVELYGPTM-------QPLFDFSWL
E2RS00_BCL2A1-01      SYFVAEFITRNMRDWIRQNGGWENGFVKKFEP------------------
F1PAP1_MCL1-01        AESITDVLVRTKRDWLVKQRGWD-GFVEFFHVED---------------L
Q8HYS5_MCL1-01        AESITDVLVRTKRDWLVKQRGWD-GFVEFFHVED---------------L
                      :  ::  :      *: .: **:  **: :                    

F1PAP1_MCL1-02        EGGIRNVLLAFAGVAGVGAGLAYLIR---
E2RS00_BCL2A1-02      TF-----LEVLGTVCEMWSHLKQYY----
Q76LT7_BCL2L1-01      --RWFLTGMTVAGVVLLGSLFSRK-----
E2QWA1_BCL2-02        SLKALLSLALVGACITLGAYLGHK-----
Q6R755_BCL2-01        SLKALLSLALVGACITLGAYLGHK-----
E2QWA1_BCL2-01        SLKALLSLALVGACITLGAYLGHK-----
Q75SV7_BCL2-01        SLKALLSLALVGACITLGAYLGHK-----
E2RS00_BCL2A1-01      ----KSGWLTFLEVLGTVCEMWSHLKQYY
F1PAP1_MCL1-01        EGGIRNVLLAFAGVAGVGAGLAYLIR---
Q8HYS5_MCL1-01        EGGIRNVLLAFAGVAGVGAGLAYLIR---
                                .       . :        

© 1998-2020Legal notice