Dataset for protein Bcl-2 of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:****************************.*:..*** ****:***** **   *:**     .. ::*  . .*   
MAqAGRTGYDNREIVMKYIHYKLSQRGYEWDvGevgAAPpGAAPtPGIFSsQPgsnPtPAvtspppprtsPlrpivA---
  h                            a dad   l    a     f  era a  rhrdmaapaa aaaaa aad

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
::**: ************.*************************************************************
ttGPtpSPVPPVVHLTLRrAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
aa  al            q                                                             

       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
*******************************************************************************
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                                                                               
© 1998-2022Legal notice