Dataset for protein Bcl-2 of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             *   .                              
mahagrtgydnreivmkyihyklsqrgyewdageagaappgaapaPgifssqpxsxpxpaxxspppppxxpaaaaaaa--
--------------------------------------------- fqsggcxvxnxtxxvtxxxxxxtsxxxxxxxxfp
  q                            v dvd   l    t    af  grfsg erhrdmaargp lrpiv tad
                                                     e a a  la      aa          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      ************.*********** *************************************************
--gpxxSPVPPVVHLTLRqAGDDFSRRYRR-FAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
pt--tp            r           d                                                 
ara al                                                                          
 a                                                                              

       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
*******************************************************************************
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                                                                               
                                                                               
                                                                               
© 1998-2020Legal notice