Dataset for protein Bcl-2 of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|E2QWA1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL-2 (length=193 residues).
PFQFGGCPVSFSGPELASPPPPPGPPAAAAAAAFPPRAPXXSPVPPVVHLTLRQAGDDFSRRYRRFAEMSSQLHLTPFTA
RGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTM
QPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|E2QWA1_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL-2 (length=232 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISASQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
SPVPPVVHLTLRQAGDDFSRRYRRFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|Q6R755_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTG
PTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|Q75SV7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGIFSSQPGRAPAPARTSPPPPPAAPAAAAAAAAD
AAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
© 1998-2020Legal notice