Dataset for protein Bcl-2 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6R755_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPA
Q75SV7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGIFSSQPGRAPAPA
                    **:****************************.*:..*** ****:***** **   *:**

Q6R755_BCL2-01      VHRDMAARTSPLRPIVA---TTGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLH
Q75SV7_BCL2-01      RTSPPPPPAAPAAAAAAAADAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
                         .. ::*  . .*   ::**: ************.*********************

Q6R755_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
Q75SV7_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
                    ************************************************************

Q6R755_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Q75SV7_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                    ***********************************************************

© 1998-2022Legal notice