Dataset for protein Bcl-2 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0NC28_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISA
A0A8C0NC28_BCL2-03      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISA
A0A8C0NC28_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISA
Q75SV7_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGIFS
Q6R755_BCL2-01          MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFS
A0A8I3MLT5_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISA
A0A8I3MLT5_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISA
                        **:****************************.*:..*** ****:*** :

A0A8C0NC28_BCL2-02      SQPGRAPAPARTSPPPPPAAPAAAAAAAAAAAGPAPSPVPPVVHLTLRQA
A0A8C0NC28_BCL2-03      SQPGRAPAPARTSPPPPPAAPAAAAAAAAAAAGPAPSPVPPVVHLTLRQA
A0A8C0NC28_BCL2-01      SQPGRAPAPARTSPPPPPAAPAAAAAAAAAAAGPAPSPVPPVVHLTLRQA
Q75SV7_BCL2-01          SQPGRAPAPARTSPPPPPAAPAAAAAAAADAAGPAPSPVPPVVHLTLRQA
Q6R755_BCL2-01          FQPESNPTPAVHRDMAARTSPLRPIVA---TTGPTLSPVPPVVHLTLRRA
A0A8I3MLT5_BCL2-01      SQPGRAPAPARTSPPPPPAAPAAAAAA---AAGPAPSPVPPVVHLTLRQA
A0A8I3MLT5_BCL2-02      SQPGRAPAPARTSPPPPPAAPAAAAAA---AAGPAPSPVPPVVHLTLRQA
                         **   *:**     .. ::*  . .*   ::**: ************.*

A0A8C0NC28_BCL2-02      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
A0A8C0NC28_BCL2-03      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
A0A8C0NC28_BCL2-01      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
Q75SV7_BCL2-01          GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
Q6R755_BCL2-01          GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
A0A8I3MLT5_BCL2-01      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
A0A8I3MLT5_BCL2-02      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
                        **************************************************

A0A8C0NC28_BCL2-02      FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWMTWVF
A0A8C0NC28_BCL2-03      FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWSPHPL
A0A8C0NC28_BCL2-01      FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
Q75SV7_BCL2-01          FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
Q6R755_BCL2-01          FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
A0A8I3MLT5_BCL2-01      FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
A0A8I3MLT5_BCL2-02      FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWSPHPL
                        ********************************************* .   

A0A8C0NC28_BCL2-02      LLVLLSFPCVH-SWPLVQCQAPWPWPPHSPA--------
A0A8C0NC28_BCL2-03      MVSSAEKTCVYSVYIKHRSIDSHLWILSCSDFSCSDRCL
A0A8C0NC28_BCL2-01      LYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Q75SV7_BCL2-01          LYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Q6R755_BCL2-01          LYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
A0A8I3MLT5_BCL2-01      LYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
A0A8I3MLT5_BCL2-02      MVSSAEKTCVYSVYIKHRSIDSHLWILSCSDFSCSDRCL
                        :      . .   :   ..  .      .          

© 1998-2023Legal notice