Dataset for protein Bcl-2 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E2QWA1_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISASQXXXXXXXX
Q6R755_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPA
E2QWA1_BCL2-01      ---------------------------------------------PFQFGGCPVSFSGPE
Q75SV7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGIFSSQPGRAPAPA
                                                                 *   .          

E2QWA1_BCL2-02      XXXXXXXXXXXXXXXXXX------XXSPVPPVVHLTLRQAGDDFSRRYRR-FAEMSSQLH
Q6R755_BCL2-01      VHRDMAARTSPLRPIVAT---TGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLH
E2QWA1_BCL2-01      LASPPPPPGPPAAAAAAAFPPRAPXXSPVPPVVHLTLRQAGDDFSRRYRR-FAEMSSQLH
Q75SV7_BCL2-01      RTSPPPPPAAPAAAAAAAADAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
                                              ************.*********** *********

E2QWA1_BCL2-02      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
Q6R755_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
E2QWA1_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
Q75SV7_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
                    ************************************************************

E2QWA1_BCL2-02      LNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Q6R755_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
E2QWA1_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Q75SV7_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                    ***********************************************************

© 1998-2020Legal notice