Dataset for protein Bcl-2 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q75SV7_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGIFS
A0A8C0RVL3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISA
Q6R755_BCL2-01          MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFS
                        **:****************************.*:..*** ****:*** :

Q75SV7_BCL2-01          SQPGRAPAPARTSPPPPPAAPAAAAAAAADAAGPAPSPVPPVVHLTLRQA
A0A8C0RVL3_BCL2-01      SQPGRAPAPARTSPPPPPAAPAAAAAA---AAGPAPSPVPPVVHLTLRQA
Q6R755_BCL2-01          FQPESNPTPAVHRDMAARTSPLRPIVA---TTGPTLSPVPPVVHLTLRRA
                         **   *:**     .. ::*  . .*   ::**: ************.*

Q75SV7_BCL2-01          GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
A0A8C0RVL3_BCL2-01      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
Q6R755_BCL2-01          GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
                        **************************************************

Q75SV7_BCL2-01          FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
A0A8C0RVL3_BCL2-01      FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
Q6R755_BCL2-01          FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
                        **************************************************

Q75SV7_BCL2-01          LYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
A0A8C0RVL3_BCL2-01      LYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Q6R755_BCL2-01          LYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                        ***************************************

© 1998-2022Legal notice