Dataset for protein BCL-2-like of organism Buteo japonicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
            *         *..   .:   .                      :             .    .    
mahpgrms---m vrtkfyyly cssymqyvlsseedenr----a--ae--slvgass---vhvlvniavsmqassptsl
      rgyngl talfqiv v reld fgq lsrrgggtep-ps--tpphaap qtrwlacgrfgisclpdqkesdh
        gd   i e  fh     d    aaa       dral ap  sl a    a hva  aaaa a  a g  ea 

        90       100       110       120       130       140       150       160
  ::                                         .  *    * **  ****::::: **. :     .
temls-kpetsvlreagdefelryrrafsdltsqlhitpsxdrrrvvg mehv s  nt    vmtlit  avvtkklqs
rprrilippk                           ev lgi ne aa k a           i e   lma h kn
dph  i g                           ae k   ca                        f      e

       170       180       190       200       210       220       230       240
            :   :*  :      *:  :***.          .                                 
rnvsrtgeeksriayii eaivsskre lmsq   srpwplspal-httkfgvgav-vvmkvpv-t------mtimkdwr
igqqpc   ieqlsgf   nrn hn  dd    dn        s lsfrrredlgneia nqfs nwwtallel    
h  el     d   a      in  a    a              a  e   nd aegc   g ek arls kf a    
                                                         e    a  d              

       250       260       270       280    
  tgsslgacll  ss sypia                      
  sfmaf   ig   l ghm                        
  a a     a    f                            
© 1998-2023Legal notice