Dataset for protein BCL-2-like of organism Buteo japonicus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8B9Z3D5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Buteo japonicus GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVAVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
AMFIAVFSLLREYY
>gnl|bcl2dbpro|A0A8C0ASR2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Buteo japonicus GN=MCL-1 (length=194 residues).
GNGLEVRTDQFYLVLCSSEMSWFGSSLSRRGGGTELLASGLTLGLVGAASSHWLPCGVFGIVCMPASKPTSLAGMLRKLE
IQKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQERCISSLAGIITDALVSSKREWLMSQGGWEGFV
DFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIR
>gnl|bcl2dbpro|A0A8C0AYR5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Buteo japonicus GN=BCL2L1 (length=230 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNGSPSWHPPASHVVNGAAMHRSSLEVHEIVQT
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
GRVVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C0AYR5_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Buteo japonicus GN=BCL2L1 (length=271 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNGSPSWHPPASHVVNGAAMHRSSLEVHEIVQT
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
GRVVSWMTTYLTDHLDPWIQENGGWSRPWPLSPALSHTSLRGRGAVAVCRAVALLKFARLLLLLEMKDWRQPAWTSRAGV
TAFLARPRAWPALPKPRERPEFHDPECLPSP
>gnl|bcl2dbpro|A0A8C0BN28_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Buteo japonicus GN=BCL-2 (length=199 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAAEDRAPLPPGLSPPAAAAAAVAAAAAAAAAAAAGTSSDHTGLVSPHPE
PPGSXARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVE
LYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
© 1998-2022Legal notice