Dataset for protein BCL-2-like of organism Buteo japonicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0AYR5_BCL2L1-      ------MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEM
A0A8C0AYR5_BCL2L1-      ------MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEM
A0A8B9Z3D5_BCL2A1-      -----------METAEFYYVYYLAQDYLQYVLQE----------------
A0A8C0ASR2_MCL1-01      --------GNGLEVRTDQFYLVLCSSEMSWFGSSLSRRGGGTELLASGLT
A0A8C0BN28_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAAE------DRAPLPPGLS
                                    *         *..   .:   .                

A0A8C0AYR5_BCL2L1-      DGVLNGSPSWHPPASHVVNGAAMHRSSLEVHEIVQTADVRQALREAGDEF
A0A8C0AYR5_BCL2L1-      DGVLNGSPSWHPPASHVVNGAAMHRSSLEVHEIVQTADVRQALREAGDEF
A0A8B9Z3D5_BCL2A1-      -SHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSV--------
A0A8C0ASR2_MCL1-01      LGLVGAASSHWLPCGVFGIVCMPASKPTSLAGMLR-KLEIQK--------
A0A8C0BN28_BCL2-01      PPAAAAAA---VAAAAAAAAAAAAGTSSDHTGLVSPHPEPPG--------
                              :             .    .      ::                

A0A8C0AYR5_BCL2L1-      ELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV-NWGRIVAFFSF
A0A8C0AYR5_BCL2L1-      ELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV-NWGRIVAFFSF
A0A8B9Z3D5_BCL2A1-      -------------------AVAKRIFNGVMEEKFADGNTNWGRIMTIFTF
A0A8C0ASR2_MCL1-01      -------------------EEDLQSVCEVAAHVFSDGVTNWGRVVTLISF
A0A8C0BN28_BCL2-01      -------------------SXARGRFVAVVEELFRDGV-NWGRIVAFFEF
                                                 .  *    * **  ****::::: *

A0A8C0AYR5_BCL2L1-      GGALCVESVDKEMRVL---VGRVVSWMTTYLTDHLDPWIQENGGWER---
A0A8C0AYR5_BCL2L1-      GGALCVESVDKEMRVL---VGRVVSWMTTYLTDHLDPWIQENGGWSRPWP
A0A8B9Z3D5_BCL2A1-      GGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWEN---
A0A8C0ASR2_MCL1-01      GAFVAKHLKSINQERC---ISSLAGIITDALVSSKREWLMSQGGWE----
A0A8C0BN28_BCL2-01      GGVMCVESVNREMSPL---VDSIAAWMTEYLNRHLHNWIQDNGGWD----
                        *. :     .            :   :*  :      *:  :***.    

A0A8C0AYR5_BCL2L1-      ------FVDLYGNDAAAEVRK-GQETFNKWLL----------TGATVAGV
A0A8C0AYR5_BCL2L1-      LSPALSHTSLRGRGAVAVCRAVALLKFARLLLLLEMKDWRQPAWTSRAGV
A0A8B9Z3D5_BCL2A1-      -----GFLTKF-------ERR-SLLSFSKITAMFIA------VFSLLREY
A0A8C0ASR2_MCL1-01      -----GFVDFFRVEDLEGSIR-NV-------------------LMAFAGV
A0A8C0BN28_BCL2-01      -----AFVELY-----GNSMR-PLFDFSWISLKTIL------SLVLVGAC
                              .                                           

A0A8C0AYR5_BCL2L1-      LLLGSLLSRK------------------------
A0A8C0AYR5_BCL2L1-      T---AFLARPRAWPALPKPRERPEFHDPECLPSP
A0A8B9Z3D5_BCL2A1-      Y---------------------------------
A0A8C0ASR2_MCL1-01      AGLGASLAYMIR----------------------
A0A8C0BN28_BCL2-01      ITLGAYLGHK------------------------
                                                          

© 1998-2022Legal notice