Dataset for protein BCL-2-like of organism Bubo bubo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            *         *                                          ..     . .     
-----------rEtvldyvvykLsqsgysws----------------------------lspp--gaavvavaavlrtsl
mahpgrrsysnm nciklyscy etrylqyvqleeegenrtplavedaemdgvlngspswrlwhlashqtrsglahgsls
      mgsd   lafffil n a kcfgaa    ad d adf             p g qesgg pelpng h a nia
             i e   h     d  d                               h  aa    a a     l  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          .:   .        :  :  .: :        .   *    * **  ****:::
svh--v-p-------------v--alreagde-------alaqmlsqlhitpvtayqsfvq-VvqelFrDGv-NWGRivt
es-tl-s-rseppgsaaashv-wy-aqqqtvsfsrryrrsfspltrrielqsgevrkrvfng mnhv s  nt    vma
dhtgisqahp           grql  dg e  el  q d rgfsgk d  kfadlg iee  ae k a           
ac ea d ad            hl                  d  d      e  a   ca   a               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:: **. :     .            :   :*  :      *:  :***    .                 :      : 
ffsFGgvlcvesvsrems---vlvssiaywmTeylvshlreWiqsnGGWe-gflvkfyg----ps-rrslmsfstiaslv
lit  alvtkklqnknvrltgpekgrlvsii maitrskhp lmeq   -rthvtglr-nsmr--lqnvwlalqkvtqip
e   fma h keigqq   kcieq sgf   nnn dn  dd    vndafpfgeveqlpglidfgsi gkgglg g
      a      dh  e   e  d   a      id  a    a         de d cdce  f a  g  a   a f

       250     
....:....|....:
     :         
avvayvtr--y----
lslismpvly-lgrk
iagfllilgdla h 
  f cif ea     
© 1998-2022Legal notice