Dataset for protein BCL-2-like of organism Bubo bubo

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C0EQC0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Bubo bubo GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVAVAKRIFNGVMQEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
AIFIAVFSLFREYY
>gnl|bcl2dbpro|A0A8C0FD84_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bubo bubo GN=MCL-1 (length=186 residues).
RENCFDLVLCNLETSCFGASLRLWGGGAELPASGLVLGLLLACHTASDPRSGWYLAQEGGVSSLAGMLRKLEIQKEEDLQ
SVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDL
EGSIRNVLMAFAGVAGLGASLAYMIR
>gnl|bcl2dbpro|A0A8C0FL84_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bubo bubo GN=BCL2L1 (length=230 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAVEDAEMDGVLNGSPSWHPPASHVVNGAAVHRSSLEVHEIVQA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
GRIVSWMTMYLTDHLDPWIQENGGWVRTHLPGGDGCQCPPSLQAGSGAGQTGAQLPAVFILVPVLDLAGR
>gnl|bcl2dbpro|A0A8C0IE77_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Bubo bubo GN=BCL-2 (length=231 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAVAAAAAAAGTSSDHTGLVSPHPEPPGSAA
ASHVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSP
LVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
© 1998-2022Legal notice