Dataset for protein BCL-2-like of organism Bubo bubo

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0FL84_BCL2L1-      ------MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAVEDAEM
A0A8C0IE77_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWA----AGEDRAPL-------
A0A8C0EQC0_BCL2A1-      -----------METAEFYYVYYLAQDYLQYV-------------------
A0A8C0FD84_MCL1-01      -----------RENCFDLVLCNLETSCFGAS-------------------
                                    *         *                           

A0A8C0FL84_BCL2L1-      DGVLNGSPSWHPP--ASHVVNGAAVHRSSLEVHEIVQAAD----------
A0A8C0IE77_BCL2-01      ------PPGLSPPAAAAAVAAAAAAAGTSSDHTGLVSPHPEPPGSAAASH
A0A8C0EQC0_BCL2A1-      ---------LQESHLGPAQTRVAHVLRNIASS------------------
A0A8C0FD84_MCL1-01      ---------LRLWGGGAELPASGLVLGLLLACHTASDPRS----------
                                       ..     . .                         

A0A8C0FL84_BCL2L1-      -VRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQ-VVNELFRD
A0A8C0IE77_BCL2-01      VVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVA-VVEELFRD
A0A8C0EQC0_BCL2A1-      -----LQDQTEE-------ALRPFLDRIDITSVAVAKRIFNGVMQEKFAD
A0A8C0FD84_MCL1-01      -GWYLAQEGGVS-------SLAGMLRKLEIQKEEDLQSVCE-VAAHVFSD
                              .:   .        :  :  .: :        .   *    * *

A0A8C0FL84_BCL2L1-      GV-NWGRIVAFFSFGGALCVESVDKEMR---VLVGRIVSWMTMYLTDHLD
A0A8C0IE77_BCL2-01      GV-NWGRIVAFFEFGGVMCVESVNREMS---PLVDSIAAWMTEYLNRHLH
A0A8C0EQC0_BCL2A1-      GNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKA
A0A8C0FD84_MCL1-01      GVTNWGRVVTLISFGAFVAKHLKSINQE---KCISSLAGIITDALVSSKR
                        *  ****::::: **. :     .            :   :*  :     

A0A8C0FL84_BCL2L1-      PWIQENGGWVRTHLPGGDGCQCPPSLQAGSGAGQTGAQLPAVFILVPVLD
A0A8C0IE77_BCL2-01      NWIQDNGGW--DAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGA
A0A8C0EQC0_BCL2A1-      EWIDANGGWENGFLTKFE--------RRSLLSFSKITAIFIAVFSLFREY
A0A8C0FD84_MCL1-01      EWLMSQGGWE-GFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIR--
                         *:  :***    .                 :      :      :    

A0A8C0FL84_BCL2L1-      LAGR-
A0A8C0IE77_BCL2-01      YLGHK
A0A8C0EQC0_BCL2A1-      Y----
A0A8C0FD84_MCL1-01      -----
                             

© 1998-2022Legal notice