Dataset for protein Mcl-1 of organism Balaenoptera musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:*****:****:** * ..                                                            
MfGLKRNaVIGLnLYcGgaglgpdsgsgasapgrrll-------------------------------------------
 l     t    k  w epdw----------------aagkeatagrevgggetgeviggsagpsppatlapdarrvarp
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
spigaegpdvtatparllffaptrrasppeemessasdaimspeeeldgcepeplgkrpavlpllelvgeasnspgkdgs
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 :*****         
------------------------------atgtkdakplgrsgaasrkaletlrrvgdgvqrnheTAFQGmlrkldikn
lpstpppaeeeedelyrqsleiisrylreq----------------------------------dq     ---------
                                                                         q      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     *  :  *:.  .   .* .      *   :. .              . *.*       
eddvkslsrvmvhvfsdgvtnWgrivtLlsfgafvakHlksinqesCieplaesitdvlvrtkrdwlvkqRgWdgfvdff
--------------------- --vcg ipcrgprrr qr------ aagfcrc-------------crs s -------
                                             i                 q     r      l   

       330       340       350 
....:....|....:....|....:....|.
                    **.  :*:   
hvedleggirnvllafagvaGVgaglAylir
-------------------f  snki f---
 g   an l                      
© 1998-2022Legal notice