Dataset for protein Mcl-1 of organism Balaenoptera musculus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C0CVU0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Balaenoptera musculus GN=MCL-1 (length=148 residues).
MLGLKRNTVIGLKLYWGEPDWDQTAFQGMLQKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLLSFGAFVAKHLRSIN
QEICIEPLAESITDVLVRTKQDWLVKRRGWDGFLDFFHGEDLANGLRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C0DF47_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Balaenoptera musculus GN=MCL-1 (length=351 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVGGGETGEVIGGSAGPSPPATLAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSASDAIMSPEEELDGCEPEPLGKRPAVLPLLELVGEASNSPGKDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPLGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVDFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C0DF47_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Balaenoptera musculus GN=MCL-1 (length=198 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLATGTKDAKPLGRSGAASRKALETLRRVGDGVQRNHETAFQGML
RKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW
DGFVDFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C0DF47_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Balaenoptera musculus GN=MCL-1 (length=271 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVGGGETGEVIGGSAGPSPPATLAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSASDAIMSPEEELDGCEPEPLGKRPAVLPLLELVGEASNSPGKDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPLGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGLLPCR
GPRRRHQKCAAGFCRCCRSRSWFGVSNKIAF
© 1998-2022Legal notice