Dataset for protein Mcl-1 of organism Balaenoptera musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0DF47_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVG
A0A8C0DF47_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVG
A0A8C0CVU0_MCL1-01      MLGLKRNTVIGLKLYWGEPDW-----------------------------
A0A8C0DF47_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLL-------------
                        *:*****:****:** * ..                              

A0A8C0DF47_MCL1-01      GGETGEVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPARLLFF
A0A8C0DF47_MCL1-02      GGETGEVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPARLLFF
A0A8C0CVU0_MCL1-01      --------------------------------------------------
A0A8C0DF47_MCL1-03      --------------------------------------------------
                                                                          

A0A8C0DF47_MCL1-01      APTRRASPPEEMESSASDAIMSPEEELDGCEPEPLGKRPAVLPLLELVGE
A0A8C0DF47_MCL1-02      APTRRASPPEEMESSASDAIMSPEEELDGCEPEPLGKRPAVLPLLELVGE
A0A8C0CVU0_MCL1-01      --------------------------------------------------
A0A8C0DF47_MCL1-03      --------------------------------------------------
                                                                          

A0A8C0DF47_MCL1-01      ASNSPGKDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPL
A0A8C0DF47_MCL1-02      ASNSPGKDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPL
A0A8C0CVU0_MCL1-01      --------------------------------------------------
A0A8C0DF47_MCL1-03      ----------------------------------------ATGTKDAKPL
                                                                          

A0A8C0DF47_MCL1-01      GRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A8C0DF47_MCL1-02      GRSGAASRKALETLRRVGDGVQRNHETAFQG-------------------
A0A8C0CVU0_MCL1-01      ------------------------DQTAFQGMLQKLDIKNEDDVKSLSRV
A0A8C0DF47_MCL1-03      GRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
                                                 :*****                   

A0A8C0DF47_MCL1-01      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
A0A8C0DF47_MCL1-02      -----------W--VCGLLPCRGPRRRHQK------CAAGFCRC------
A0A8C0CVU0_MCL1-01      MVHVFSDGVTNWGRIVTLLSFGAFVAKHLRSINQEICIEPLAESITDVLV
A0A8C0DF47_MCL1-03      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
                                   *  :  *:.  .   .* .      *   :. .      

A0A8C0DF47_MCL1-01      RTKRDWLVKQRGWDGFVDFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
A0A8C0DF47_MCL1-02      -------CRSRSW--------------------------FGVSNKIAF--
A0A8C0CVU0_MCL1-01      RTKQDWLVKRRGWDGFLDFFHGEDLANGLRNVLLAFAGVAGVGAGLAYLI
A0A8C0DF47_MCL1-03      RTKRDWLVKQRGWDGFVDFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLI
                                . *.*                           **.  :*:  

A0A8C0DF47_MCL1-01      R
A0A8C0DF47_MCL1-02      -
A0A8C0CVU0_MCL1-01      R
A0A8C0DF47_MCL1-03      R
                         

© 1998-2022Legal notice