Dataset for protein BCL-2-like of organism Balaenoptera musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             .                                  
-------mtglkrrevvglylyy--------------------gspglgpdsgsgssapgrtpl----------------
mtmahagrf-ydnnaiimknihcklsqrgyewsqfsdagdagtagaeaa-ap-ifa-q---rlaaagkeatagrevggge
  dsef --s------------w    k  s      vdenr pt ds-e--r---a-ivg---                
       ymhqsaqtylvyv sm                    eq awt stmetv dfn yks                
        l ml  dl kdk qi                     e  g   d alp     n                  
        i          f                        a                                   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tgeviggsagpsppatlapdarrvarpspigaegpdvtatparllffaptrrasppeemessasdaimspeeeldgcepe
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------ptrtsppppqgasgaas------
plgkrpavlpllelvgeasnspgkdgslpstpppaeeeedelyrqsleiisrylreqasg-kdak-ltrpa-paggpals
                                                         ---g----v-----p--sld re
                                                         wqlayvcganpgt hs       
                                                         rhk ds a g  e          
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         :                                 *  :  ::   .         
----rkvhltlrragdgfqrryrraFqgmlsqlhitp-ftarksfstVveelFrdG-vNWGRiVaffsFggvvcvesvnr
pvpmpvalea--qv--dvs-nhetdlaelsrk-dlknieddvgrlar-mvhv-s--vt- --vctllecrafmakhlksi
vi  ----q-mq--afe-et-vqkt sd----i-v-- g---q---q ---- -g i-    l giiv e alrrkqr-k
    spts-v  ei  - -nef  n kpftqn  -vs -s y-i t- snre q   p         p   pria  lg-
    dalkr   d   s  l d       ad       d  qt  n   d   e             a   i      de
    a       a                 a              e                                  
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           .                    .*                                              
emeplvd---piaewmteylnrhlhdWiqkngGWdgfvd-------lesglr--------vllafagvagvga----gla
nqsscietyknlslsiadv-v-tkrt-lvdsrs -----lfhvedf-gpsk-qlttnwwn--------f--a-cvtv---
----das   rvqyf----i-t---- -rsq   ttplefygnyaayag-isperkysyltvtvltsl-ts-nvsllqay
riqv  g   qfcrcvvtf tkrtqp  hrr   hkdtpivignf s--v-kmrpgsrassrknvltmvllslllikkyl
  ai  a   g  a   a  edn ge  cq    ei ki   dg  ncnrvglmgffg eafge p gmdeigi    sf
          e             e    e    ae  a       c fhr f fe a         aic  d     i 
                        a          a          a eam e ed             a          

    
....
    
----
ylir
fssk
lgr 
 ah 
    
    
© 1998-2022Legal notice