Dataset for protein BCL-2-like of organism Balaenoptera musculus

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A8B8V3A7_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL-2 (length=232 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFSSQPGRTPAPSRTSPPPPQTAPAAPAGGPAL
SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIALWMTEYLNRHLHTWIQDNGGWHIPLIIVINYFFCASHLSELGTYAYEAVGNFPSLFDSADISIV
>gnl|bcl2dbpro|A0A8B8V3A7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL-2 (length=233 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFSSQPGRTPAPSRTSPPPPQTAPAAPAGGPAL
SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACVTLGAYLGHK
>gnl|bcl2dbpro|A0A8B8V3A7_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL-2 (length=204 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFSSQPGRTPAPSRTSPPPPQTAPAAPAGGPAL
SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIALWMTEYLNRHLHTWIQDNGGWTKDKPSCPSVRMMTE
>gnl|bcl2dbpro|A0A8B8VBB9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8B8WSS7_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C0CSU7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2A1 (length=175 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPFLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWENGFVKKFEPKSGWLTFLEV
TGMICEILCLLKQYY
>gnl|bcl2dbpro|A0A8C0CVU0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Balaenoptera musculus GN=MCL-1 (length=148 residues).
MLGLKRNTVIGLKLYWGEPDWDQTAFQGMLQKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLLSFGAFVAKHLRSIN
QEICIEPLAESITDVLVRTKQDWLVKRRGWDGFLDFFHGEDLANGLRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C0DF47_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Balaenoptera musculus GN=MCL-1 (length=351 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVGGGETGEVIGGSAGPSPPATLAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSASDAIMSPEEELDGCEPEPLGKRPAVLPLLELVGEASNSPGKDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPLGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVDFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C0DF47_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Balaenoptera musculus GN=MCL-1 (length=198 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLATGTKDAKPLGRSGAASRKALETLRRVGDGVQRNHETAFQGML
RKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW
DGFVDFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C0DF47_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Balaenoptera musculus GN=MCL-1 (length=271 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVGGGETGEVIGGSAGPSPPATLAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSASDAIMSPEEELDGCEPEPLGKRPAVLPLLELVGEASNSPGKDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPLGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGLLPCR
GPRRRHQKCAAGFCRCCRSRSWFGVSNKIAF
© 1998-2022Legal notice