Dataset for protein BCL-2-like of organism Balaenoptera musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0DF47_MCL1-01      -------MFGLKRNAVIGLNLYC--------------------GGAGLGP
A0A8C0DF47_MCL1-02      -------MFGLKRNAVIGLNLYC--------------------GGAGLGP
A0A8C0CSU7_BCL2A1-      MTDSEFGYIHMLAQDYLKYVLQI--------------------PQPGSGP
A0A8B8VBB9_BCL2L1-      --------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTE
A0A8B8V3A7_BCL2-02      --MAHAGRTGYDNREIVMKYIHYKLSQRGYEW----DAGDAGTASPGAAP
A0A8B8V3A7_BCL2-01      --MAHAGRTGYDNREIVMKYIHYKLSQRGYEW----DAGDAGTASPGAAP
A0A8B8V3A7_BCL2-03      --MAHAGRTGYDNREIVMKYIHYKLSQRGYEW----DAGDAGTASPGAAP
A0A8B8WSS7_BCL2L2-      ----------------------M--------------------ATPASAP
A0A8C0CVU0_MCL1-01      -------MLGLKRNTVIGLKLYW--------------------GEPDW--
A0A8C0DF47_MCL1-03      -------MFGLKRNAVIGLNLYC--------------------GGAGLGP
                                                                     .    

A0A8C0DF47_MCL1-01      DSGSGASAPGRRLLAAGKEATAGREVGGGETGEVIGGSAGPSPPATLAPD
A0A8C0DF47_MCL1-02      DSGSGASAPGRRLLAAGKEATAGREVGGGETGEVIGGSAGPSPPATLAPD
A0A8C0CSU7_BCL2A1-      --------------------------------------------------
A0A8B8VBB9_BCL2L1-      SDMETPSAINGNPS------------------------------------
A0A8B8V3A7_BCL2-02      APGIFSSQPGRTPA------------------------------------
A0A8B8V3A7_BCL2-01      APGIFSSQPGRTPA------------------------------------
A0A8B8V3A7_BCL2-03      APGIFSSQPGRTPA------------------------------------
A0A8B8WSS7_BCL2L2-      DTRALVADFVGYKL------------------------------------
A0A8C0CVU0_MCL1-01      --------------------------------------------------
A0A8C0DF47_MCL1-03      DSGSGASAPGRRLL------------------------------------
                                                                          

A0A8C0DF47_MCL1-01      ARRVARPSPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSASDAIMSP
A0A8C0DF47_MCL1-02      ARRVARPSPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSASDAIMSP
A0A8C0CSU7_BCL2A1-      --------------------------------------------------
A0A8B8VBB9_BCL2L1-      --------------------------------------------------
A0A8B8V3A7_BCL2-02      --------------------------------------------------
A0A8B8V3A7_BCL2-01      --------------------------------------------------
A0A8B8V3A7_BCL2-03      --------------------------------------------------
A0A8B8WSS7_BCL2L2-      --------------------------------------------------
A0A8C0CVU0_MCL1-01      --------------------------------------------------
A0A8C0DF47_MCL1-03      --------------------------------------------------
                                                                          

A0A8C0DF47_MCL1-01      EEELDGCEPEPLGKRPAVLPLLELVGEASNSPGKDGSLPSTPPPAEEEED
A0A8C0DF47_MCL1-02      EEELDGCEPEPLGKRPAVLPLLELVGEASNSPGKDGSLPSTPPPAEEEED
A0A8C0CSU7_BCL2A1-      --------------------------------------------------
A0A8B8VBB9_BCL2L1-      --------------------------------------------------
A0A8B8V3A7_BCL2-02      --------------------------------------------------
A0A8B8V3A7_BCL2-01      --------------------------------------------------
A0A8B8V3A7_BCL2-03      --------------------------------------------------
A0A8B8WSS7_BCL2L2-      --------------------------------------------------
A0A8C0CVU0_MCL1-01      --------------------------------------------------
A0A8C0DF47_MCL1-03      --------------------------------------------------
                                                                          

A0A8C0DF47_MCL1-01      ELYRQSLEIISRYLREQATGTKDAKPLGRSGAAS----------RKALET
A0A8C0DF47_MCL1-02      ELYRQSLEIISRYLREQATGTKDAKPLGRSGAAS----------RKALET
A0A8C0CSU7_BCL2A1-      --------------------------------------------SKTSRV
A0A8B8VBB9_BCL2L1-      -----------------WHLADSPAVNGATGHSSSLDAREVIPMAAVKQA
A0A8B8V3A7_BCL2-02      -----------------PSRTSPPPPQTAPAAPAGGPALSPVP-PVVHLT
A0A8B8V3A7_BCL2-01      -----------------PSRTSPPPPQTAPAAPAGGPALSPVP-PVVHLT
A0A8B8V3A7_BCL2-03      -----------------PSRTSPPPPQTAPAAPAGGPALSPVP-PVVHLT
A0A8B8WSS7_BCL2L2-      -----------------RQKGYVCGAGPGEGPAA----------DPLHQA
A0A8C0CVU0_MCL1-01      --------------------------------------------------
A0A8C0DF47_MCL1-03      -----------------ATGTKDAKPLGRSGAAS----------RKALET
                                                                          

A0A8C0DF47_MCL1-01      LRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSRVMVHVFSDGVTNW
A0A8C0DF47_MCL1-02      LRRVGDGVQRNHETAFQG-------------------------------W
A0A8C0CSU7_BCL2A1-      LQDIAFSVQNEVEKNLKPFLDNIDVVSIDTARTIFNQVMEREFEDGIVNW
A0A8B8VBB9_BCL2L1-      LREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDG-VNW
A0A8B8V3A7_BCL2-02      LRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDG-VNW
A0A8B8V3A7_BCL2-01      LRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDG-VNW
A0A8B8V3A7_BCL2-03      LRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDG-VNW
A0A8B8WSS7_BCL2L2-      MRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGG-PNW
A0A8C0CVU0_MCL1-01      -----------DQTAFQGMLQKLDIKN-EDDVKSLSRVMVHVFSDGVTNW
A0A8C0DF47_MCL1-03      LRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSRVMVHVFSDGVTNW
                                       :                                 *

A0A8C0DF47_MCL1-01      GRIVTLISFGAFVAKHLKSINQESCIE---PLAESITDVLVRTKRDWLVK
A0A8C0DF47_MCL1-02      --VCGLLPCRGPRRRHQK------CAA---GFCRC-------------CR
A0A8C0CSU7_BCL2A1-      GRIVTIFAFEGILIKKLLGERIAPDVDTYKEISYFVAEFITKNTGEWIRQ
A0A8B8VBB9_BCL2L1-      GRIVAFFSFGGALCVESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQE
A0A8B8V3A7_BCL2-02      GRIVAFFEFGGVMCVESVNREMSPLVD---NIALWMTEYLNRHLHTWIQD
A0A8B8V3A7_BCL2-01      GRIVAFFEFGGVMCVESVNREMSPLVD---NIALWMTEYLNRHLHTWIQD
A0A8B8V3A7_BCL2-03      GRIVAFFEFGGVMCVESVNREMSPLVD---NIALWMTEYLNRHLHTWIQD
A0A8B8WSS7_BCL2L2-      GRLVAFFVFGAALCAESVNKEMEPLVG---QVQEWMVAYLETRLADWIHS
A0A8C0CVU0_MCL1-01      GRIVTLLSFGAFVAKHLRSINQEICIE---PLAESITDVLVRTKQDWLVK
A0A8C0DF47_MCL1-03      GRIVTLISFGAFVAKHLKSINQESCIE---PLAESITDVLVRTKRDWLVK
                          :  ::   .                    .                  

A0A8C0DF47_MCL1-01      QRGWDGFVDFFHVED-LEGGIR-------NVLLAFAGVAGVGA----GLA
A0A8C0DF47_MCL1-02      SRSW----------------------------------FGVSN----KIA
A0A8C0CSU7_BCL2A1-      NGGWE-----------NGFVKKFEPKSGWLTFLEVTGMICEILCLLKQYY
A0A8B8VBB9_BCL2L1-      NGGWDTFVELYGNNAAAESRKGQERFNRW-----FLTGMTVAGVVLLGSL
A0A8B8V3A7_BCL2-02      NGGWHIPLIIVINYFFCASHLSELGTYAYEAVGNFPSLFDSADISIV---
A0A8B8V3A7_BCL2-01      NGGWDAFVEL------YGPSMRPLFDFSWLSLKALLSLALVGACVTLGAY
A0A8B8V3A7_BCL2-03      NGGWTKDKP-------SCPSVRMMTE------------------------
A0A8B8WSS7_BCL2L2-      SGGWAEFTALYGDGA-LEEARRLREGNWASVRTVLTGAVALGALVTVGAF
A0A8C0CVU0_MCL1-01      RRGWDGFLDFFHGED-LANGLR-------NVLLAFAGVAGVGA----GLA
A0A8C0DF47_MCL1-03      QRGWDGFVDFFHVED-LEGGIR-------NVLLAFAGVAGVGA----GLA
                          .*                                              

A0A8C0DF47_MCL1-01      YLIR
A0A8C0DF47_MCL1-02      F---
A0A8C0CSU7_BCL2A1-      ----
A0A8B8VBB9_BCL2L1-      FSRK
A0A8B8V3A7_BCL2-02      ----
A0A8B8V3A7_BCL2-01      LGHK
A0A8B8V3A7_BCL2-03      ----
A0A8B8WSS7_BCL2L2-      FASK
A0A8C0CVU0_MCL1-01      YLIR
A0A8C0DF47_MCL1-03      YLIR
                            

© 1998-2022Legal notice