Dataset for protein Bcl-2 of organism Balaenoptera musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFSSQPGRTPAPSRTSPPPPQTAPAAPAGGPAL
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
                                                                                
                                                                                

       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
*****************************              . :  :                              
SPLVDNIALWMTEYLNRHLHTWIQDNGGWtkpvp-------ygpsvrpltt----------sl----------------
                             hiflilvinyffscshmsmmgeysylsvknlp--flvgdivtvgaylghk
                             dadkei      ca  l e fdfawealgafl  adsaacsil       
© 1998-2022Legal notice