Dataset for protein Bcl-2 of organism Balaenoptera musculus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8B8V3A7_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL-2 (length=232 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFSSQPGRTPAPSRTSPPPPQTAPAAPAGGPAL
SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIALWMTEYLNRHLHTWIQDNGGWHIPLIIVINYFFCASHLSELGTYAYEAVGNFPSLFDSADISIV
>gnl|bcl2dbpro|A0A8B8V3A7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL-2 (length=233 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFSSQPGRTPAPSRTSPPPPQTAPAAPAGGPAL
SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACVTLGAYLGHK
>gnl|bcl2dbpro|A0A8B8V3A7_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL-2 (length=204 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFSSQPGRTPAPSRTSPPPPQTAPAAPAGGPAL
SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIALWMTEYLNRHLHTWIQDNGGWTKDKPSCPSVRMMTE
© 1998-2022Legal notice