Dataset for protein Bcl-2 of organism Balaenoptera musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B8V3A7_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFS
A0A8B8V3A7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFS
A0A8B8V3A7_BCL2-03      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFS
                        **************************************************

A0A8B8V3A7_BCL2-02      SQPGRTPAPSRTSPPPPQTAPAAPAGGPALSPVPPVVHLTLRQAGDDFSR
A0A8B8V3A7_BCL2-01      SQPGRTPAPSRTSPPPPQTAPAAPAGGPALSPVPPVVHLTLRQAGDDFSR
A0A8B8V3A7_BCL2-03      SQPGRTPAPSRTSPPPPQTAPAAPAGGPALSPVPPVVHLTLRQAGDDFSR
                        **************************************************

A0A8B8V3A7_BCL2-02      RYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGV
A0A8B8V3A7_BCL2-01      RYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGV
A0A8B8V3A7_BCL2-03      RYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGV
                        **************************************************

A0A8B8V3A7_BCL2-02      MCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWHIPLIIVINYF
A0A8B8V3A7_BCL2-01      MCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVEL-----
A0A8B8V3A7_BCL2-03      MCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWTKDKP------
                        ***************************************           

A0A8B8V3A7_BCL2-02      FCASHLSELGTYAYEAVGNFPSLFDSADISIV-------
A0A8B8V3A7_BCL2-01      -YGPSMRPLFDFSWLSLKALLSLALVGACVTLGAYLGHK
A0A8B8V3A7_BCL2-03      -SCPSVRMMTE----------------------------
                           . :  :                              

© 1998-2022Legal notice