Dataset for protein BCL-2-like of organism Aquila chrysaetos chrysaetos

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .     :  ..                   .                                   
---p--aststreaaar--pyrlsqrg------eggpapppptaaaaaevpgvlig---a-----------sprpepprs
sgt-ss----naatvlkyyvwkpprkyyswvqq-srlpnrttrvpp------t---svg-waassdhtglvag---h--a
mah grrgyd-m l iffvs d lqysll ehdglaqgls hp amda-anaaaa agt        --swh- g-
      m s    i ed ih        d aaa deae   df  ee  aa   a                  h    a 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lvgcgaapraalppaarp--------------------------------------------------------------
------------------galwspeeeldgcepeaergpagdslpgtppgppeppdglrqdslelisrylreaageaepa
havsh pthrsslevpqv                                                              
a an    aeg    hei                                                              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            .**  .. .  .    :  :  .: :         .  *    * **  ***
--------------------vvm-----tLRrvgdgvmqryerafqgmlrqlhitpetdlqs-fceVveevFsDGvtNWG
vkkllpgllggpgrpggsgda--ekalea  qaasefsrkhrldlsqltskielqkveaykrivvq aahl r  n-   
                    -qtadvrqv  ni  slqlqtqe  rpfsgr d  sgavrg   ng mn k a       
                     hl            ed      ad  d      f  a    ea              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*::::: **. :     .            :   :*  :      *:  :***:  *:  :               *   
RivtlfsFGgfvckhlvsinqerl---vsslagwiTeylvsskreWiqsnGGWe-gFvdlfr-ndl----rnvlmaFa--
 vmafit  avlavesknremsvcgeeigrivyim daitrhlhp lmeq   dnr ltfygve--egsi---rpt sfs
    i e   lmt k qekgvrpt   keqvssf   nnn dn  dd      a  ek e -smaaev rsqls n  
          a      dh  ql     d   a      id  a    a                a     kg el d  

       330       340       350       360     
....:....|....:....|....:....|....:....|....:
                  :.                         
--------------gvaglgaslaym-------------------
wislkwlltlvtvmfilvfsslrsrkirlqvpmriycfgnrkwkn
     ti skilagacit  ly ghy                   
         ga  a   l     e                     
© 1998-2020Legal notice