Dataset for protein BCL-2-like of organism Aquila chrysaetos chrysaetos

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A663E5S6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVAVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
AMFIAVFSLLREYY
>gnl|bcl2dbpro|A0A663ECL2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=BCL2L1 (length=230 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNGSPSWHPPASHVVNGAATHRSSLEVHEIVQT
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
GRVVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A663EQJ0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=MCL-1 (length=327 residues).
SGTPSSASTSTAAAAARPWRPPRRGGGPAPPPPTAAAAAEVPGTLIGSVGAWAAAGRPEHPRALVGCGAAPRAALPPAAR
PGALWSPEEELDGCEPEAERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYLREAAGEAEPAVKKLLPGLLGGPGRPGG
SGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIQKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKS
INQERCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIRLQVPMRIYCF
GNRKWKN
>gnl|bcl2dbpro|A0A663EQJ0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=MCL-1 (length=310 residues).
SGTPSSASTSTAAAAARPWRPPRRGGGPAPPPPTAAAAAEVPGTLIGSVGAWAAAGRPEHPRALVGCGAAPRAALPPAAR
PGALWSPEEELDGCEPEAERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYLREAAGEAEPAVKKLLPGLLGGPGRPGG
SGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIQKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKS
INQERCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIR
>gnl|bcl2dbpro|A0A663FHR0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=BCL-2 (length=245 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAAEDRAPLPPGLSPPPAAAAAVAAAAAAAAGTSSDHTGLVSPHPEPPGS
AAASHAPPAEGLPPAPQVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFG
GVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGA
YLGHK
© 1998-2020Legal notice