Dataset for protein BCL-2-like of organism Aquila chrysaetos chrysaetos

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A663E5S6_BCL2A1-      -----------METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAH----
A0A663EQJ0_MCL1-02      SGTPSSASTSTAAAAAR--PWRPPRRG-------GGPAPPPPTAAAAAEV
A0A663EQJ0_MCL1-01      SGTPSSASTSTAAAAAR--PWRPPRRG-------GGPAPPPPTAAAAAEV
A0A663ECL2_BCL2L1-      ------MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEM
A0A663FHR0_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAAEDRAPLPPGLSPPPAAA
                                      .     :  ..                   .     

A0A663E5S6_BCL2A1-      --------------------------------------------------
A0A663EQJ0_MCL1-02      PGTLIGSVGAWAA--------AGRPEHPRALVGCGAAPRAALPPAARPGA
A0A663EQJ0_MCL1-01      PGTLIGSVGAWAA--------AGRPEHPRALVGCGAAPRAALPPAARPGA
A0A663ECL2_BCL2L1-      DGVLNG---------------SPSWHPPASHVVNGAATHRSSLEVHEI--
A0A663FHR0_BCL2-01      AAVAAAAAAAAGTSSDHTGLVSPHPEPPGSAAASHAPPAEGLPPAPQV--
                                                                          

A0A663E5S6_BCL2A1-      --------------------------------------------------
A0A663EQJ0_MCL1-02      LWSPEEELDGCEPEAERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYL
A0A663EQJ0_MCL1-01      LWSPEEELDGCEPEAERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYL
A0A663ECL2_BCL2L1-      --------------------------------------------------
A0A663FHR0_BCL2-01      --------------------------------------------------
                                                                          

A0A663E5S6_BCL2A1-      --------------------------------------VLRNIASSLQDQ
A0A663EQJ0_MCL1-02      REAAGEAEPAVKKLLPGLLGGPGRPGGSGDAVMEKALETLRRVGDGVMQK
A0A663EQJ0_MCL1-01      REAAGEAEPAVKKLLPGLLGGPGRPGGSGDAVMEKALETLRRVGDGVMQK
A0A663ECL2_BCL2L1-      ------------------------------VQTADVRQALREAGDEFELR
A0A663FHR0_BCL2-01      ------------------------------VHL-----ALRQAGDEFSRR
                                                              .**  .. .  .

A0A663E5S6_BCL2A1-      TEEALRPFLDRIDITSVAVAKRIFNGVMEEKFADGNTNWGRIMTIFTFGG
A0A663EQJ0_MCL1-02      HELAFQGMLRKLEIQKEEDLQS-VCEVAAHVFSDGVTNWGRVVTLISFGA
A0A663EQJ0_MCL1-01      HELAFQGMLRKLEIQKEEDLQS-VCEVAAHVFSDGVTNWGRVVTLISFGA
A0A663ECL2_BCL2L1-      YRRAFSDLTSQLHITPGTAYQS-FEQVVNELFRDGV-NWGRIVAFFSFGG
A0A663FHR0_BCL2-01      YQRDFAQMSGQLHLTPFTARGR-FVAVVEELFRDGV-NWGRIVAFFEFGG
                            :  :  .: :         .  *    * **  ****::::: **.

A0A663E5S6_BCL2A1-      LLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTK
A0A663EQJ0_MCL1-02      FVAKHLKSINQERC---ISSLAGIITDALVSSKREWLMSQGGWE-GFVDF
A0A663EQJ0_MCL1-01      FVAKHLKSINQERC---ISSLAGIITDALVSSKREWLMSQGGWE-GFVDF
A0A663ECL2_BCL2L1-      ALCVESVDKEMRVL---VGRVVSWMTTYLTDHLDPWIQENGGWE-RFVDL
A0A663FHR0_BCL2-01      VMCVESVNREMSPL---VDSIAAWMTEYLNRHLHNWIQDNGGWD-AFVEL
                         :     .            :   :*  :      *:  :***:  *:  

A0A663E5S6_BCL2A1-      FE--------RRSLLSFS-----------KITAMFIAVFSLLREYY----
A0A663EQJ0_MCL1-02      FRVEDLEGSIRNVLMAFA----------------GVAGLGASLAYMIRLQ
A0A663EQJ0_MCL1-01      FRVEDLEGSIRNVLMAFA----------------GVAGLGASLAYMIR--
A0A663ECL2_BCL2L1-      YG-NDAAAEVRKGQETFN------KWLLTGATVAGVLLLGSLLSRK----
A0A663FHR0_BCL2-01      YG-NSM-------RPLFDFSWISLKTILSLVLVGACITLGAYLGHK----
                        :               *                     :.          

A0A663E5S6_BCL2A1-      ---------------
A0A663EQJ0_MCL1-02      VPMRIYCFGNRKWKN
A0A663EQJ0_MCL1-01      ---------------
A0A663ECL2_BCL2L1-      ---------------
A0A663FHR0_BCL2-01      ---------------
                                       

© 1998-2020Legal notice