Dataset for protein BCL-2-like of organism Apteryx owenii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
spwlfphaptsfgagailrqpragrerraagrsagglasagdrrvdpwkvrrdgkpqgplaggsqretppaaagvrlcsl
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                               :                                
------------------------------rgysnrelvlkyysyklsqrgyswsqseerlpnstglavpagaalvlng-
agcsarrqpdlgcvevreqgtkhsmahpgrmssd-ppiridfvhsysapkyldyaalgdedearpdfspe-am-gaaa-t
                        rgr e ---- m taefpiv g  hpafqrvlqssha---------s--d----  
                              d aa   k a   p     d  p ngi p  rdaahq ar    rlvp  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      *  .                          .**  .  .  .
--------spsp-------------------------ePpashiasgaavgrgsrpvppvvql-----aLRqagdefsrr
ssdhtglv--hwpgvdelrqdsleligrylreaageah ggtaavnn--phdslleahei-haadvrqv  evansvelq
        a --                         g aqkrvfp-ll-----------g--ekalet  ri fglqqk
          g                               kl h   g p rpggagd vm            md 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :  :  .: :.        .  *    * **  ****::::: **. :     .            :   :*  : 
yrrafsqmtsqlhitpgtayqs-fvqVveelFrDGv-NWGRivaffsFGgvlcvesvnremsvl---vgsiatwmTeylt
tqldladlsgrielksfevrgrivea mnhv s  nt    vmtlie  samtkklqdknvrptgeekdrvvsii tain
hee  rpflrk d  kvddlk   ng aa k a           i t  alva h ksigqqlc   isqlsyf   v
     qg  d      e  a    ce                        f      eh  ek     e   g      i
                                                                                

       330       340       350       360       370       380         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
     *:  :***:   :                                             .     
rhlhtWiqenGGWe-rfvdlygndar------------kw-----lltlatvagvlllgsylsrk----
dskdp lmdq   qng-ltpfrvssaaemrkgqetfnp--sslpv--sg----a-----al--h-yygv
sn re  ds    d -  ekserrr-pvldlr tlrs sgrirntim--vlit-litsl--mi rdv  
n  a    a      a   f  hhmldlf f       e i  k   afsk g igiaffs g e    
                       ed             a           g   cfa     f      
© 1998-2022Legal notice