Dataset for protein BCL-2-like of organism Apteryx owenii

[Download (right click)] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8B9P3N9_MCL1-01        SPWLFPHAPTSFGAGAILRQPRAGRERRAAGRSAGGLASAGDRRVDPWKV
A0A8B9PRT7_BCL2-02        ------------------------------------MAHPGRRGYDNREI
A0A8B9PRT7_BCL2-01        ------------------------------------MAHPGRRGYDNREI
A0A8B9NWH6_BCL2L1-02      ------------------------------------MS------SSNREL
A0A8B9S513_BCL2A1-01      ------------------------------------META--EFYYVYYL
A0A8B9NWH6_BCL2L1-01      ------------------------------------MS------SSNREL
                                                              :            :

A0A8B9P3N9_MCL1-01        ---------R---RDGKPQGPLAGGSQRETPPAAAGVRLCSLAGCSARRQ
A0A8B9PRT7_BCL2-02        VLKYIHYKLSQRGYDWAASGDRAPASPGLSPPAAAALA---AAGTSS---
A0A8B9PRT7_BCL2-01        VLKYIHYKLSQRGYDWAASGDRAPASPGLSPPAAAALA---AAGTSS---
A0A8B9NWH6_BCL2L1-02      VIDFVSYKLSQKGYSWSQLEEEDENRTDFAVEAGMAGV---LNGS-----
A0A8B9S513_BCL2A1-01      AHDYLQYVLQES--------------------------------------
A0A8B9NWH6_BCL2L1-01      VIDFVSYKLSQKGYSWSQLEEEDENRTDFAVEAGMAGV---LNGS-----
                                                                            

A0A8B9P3N9_MCL1-01        PDLGCVEVREQGTKHSRGRPERDGAANPPKRAKPYPSGSAPPAFPRNGIS
A0A8B9PRT7_BCL2-02        --------------------DHTGLVSP--HPEPPGSAAASNAAPGDGLR
A0A8B9PRT7_BCL2-01        --------------------DHTGLVSP--HPEPPGSAAASNAAPGDGLR
A0A8B9NWH6_BCL2L1-02      ---------------------------P--SWHPPASHIVNGAAVHRSSL
A0A8B9S513_BCL2A1-01      -----------------------------------------------HLG
A0A8B9NWH6_BCL2L1-01      ---------------------------P--SWHPPASHIVNGAAVHRSSL
                                                                            

A0A8B9P3N9_MCL1-01        PRLRDAAHQAARSGADRLVPGAPGP-----PGVDELRQDSLELIGRYLRE
A0A8B9PRT7_BCL2-02        ----------------------PAP-----PVVH----------------
A0A8B9PRT7_BCL2-01        ----------------------PAP-----PVVH----------------
A0A8B9NWH6_BCL2L1-02      ----------------------EVHEIVQAADVR----------------
A0A8B9S513_BCL2A1-01      ----------------------PAQ-----TRVA----------------
A0A8B9NWH6_BCL2L1-01      ----------------------EVHEIVQAADVR----------------
                                                        . *                 

A0A8B9P3N9_MCL1-01        AAGEAEPGAKKLFPGLLGGPGRPGGAGDGVMEKALETLRRVGNGVMQKHE
A0A8B9PRT7_BCL2-02        -----------------------------------LALRQAGDEFSRRYQ
A0A8B9PRT7_BCL2-01        -----------------------------------LALRQAGDEFSRRYQ
A0A8B9NWH6_BCL2L1-02      -----------------------------------QALREAGDEFELRYR
A0A8B9S513_BCL2A1-01      -----------------------------------HVLRNIAFSLQDQTE
A0A8B9NWH6_BCL2L1-01      -----------------------------------QALREAGDEFELRYR
                                                              .**. .  .  : .

A0A8B9P3N9_MCL1-01        LAFQGMLRKLEIKKE-EDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFV
A0A8B9PRT7_BCL2-02        RDFAQMSGQLHLTPF-TARGRFVAVVEELFRDG-VNWGRIVAFFEFGSVM
A0A8B9PRT7_BCL2-01        RDFAQMSGQLHLTPF-TARGRFVAVVEELFRDG-VNWGRIVAFFEFGSVM
A0A8B9NWH6_BCL2L1-02      RAFSDLTSQLHITPG-TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGAL
A0A8B9S513_BCL2A1-01      EALRPFLDRIDITSVDVAKRIFNGVMEEKFADGNTNWGRIMTIFTFGGLL
A0A8B9NWH6_BCL2L1-01      RAFSDLTSQLHITPG-TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGAL
                            :  :  ::.:.        .  *  . * ** .****::::: **. :

A0A8B9P3N9_MCL1-01        AKHLKSINQEK-----CISSLAGIITDALVSSKREWLMSQGGWEG-FVDF
A0A8B9PRT7_BCL2-02        CV--ESVNREM---SPLVDSIATWMTEYLNRHLHTWIQDNGGWQV-TPSR
A0A8B9PRT7_BCL2-01        CV--ESVNREM---SPLVDSIATWMTEYLNRHLHTWIQDNGGWDA-FVEL
A0A8B9NWH6_BCL2L1-02      CV--ESVDKEM---RVLVGRVVSWMTTYLTDHLDPWIQENGGWER-FVDL
A0A8B9S513_BCL2A1-01      TK--KLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTK
A0A8B9NWH6_BCL2L1-01      CV--ESVDKEM---RVLVGRVVSWMTTYLTDHLDPWIQENGGWER-FVDL
                              :  ::           :   :*  :      *:  :***:      

A0A8B9P3N9_MCL1-01        FRVEDLE-GSIRN-VLMA---F-------AGVAGLGASLAYMIR
A0A8B9PRT7_BCL2-02        HHRRDV--LDLRQ-TLRSP-AWRSLPHR----------D--VGV
A0A8B9PRT7_BCL2-01        YGNSMRPLFDFS---W-ISLKTILSLVLVGACITLGAYL--GHK
A0A8B9NWH6_BCL2L1-02      YGNDAA--AEMRK-GQETFNKWLLTGATVAGVLLLGSLL--SRK
A0A8B9S513_BCL2A1-01      FERRSL--LSLSKITAIFI-AFFSL------------FR--EYY
A0A8B9NWH6_BCL2L1-01      YGNDAA--AEMRK-GQETFNKWLLTGATVAGVLLLGSLL--SRK
                          .        .:                                 

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice