Dataset for protein BCL-2-like of organism Apteryx owenii

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9S513_BCL2A1-      --------------------------------------------------
A0A8B9P3N9_MCL1-01      SPWLFPHAPTSFGAGAILRQPRAGRERRAAGRSAGGLASAGDRRVDPWKV
A0A8B9NWH6_BCL2L1-      --------------------------------------------------
A0A8B9NWH6_BCL2L1-      --------------------------------------------------
A0A8B9PRT7_BCL2-01      --------------------------------------------------
A0A8B9PRT7_BCL2-02      --------------------------------------------------
                                                                          

A0A8B9S513_BCL2A1-      --------------------------------------------------
A0A8B9P3N9_MCL1-01      RRDGKPQGPLAGGSQRETPPAAAGVRLCSLAGCSARRQPDLGCVEVREQG
A0A8B9NWH6_BCL2L1-      --------------------------------------------------
A0A8B9NWH6_BCL2L1-      --------------------------------------------------
A0A8B9PRT7_BCL2-01      --------------------------------------------------
A0A8B9PRT7_BCL2-02      --------------------------------------------------
                                                                          

A0A8B9S513_BCL2A1-      ---------------METAEFYYVYYLAHDYLQYVLQESHL---------
A0A8B9P3N9_MCL1-01      TKHSRGRPERDGAANPPKRAKPYPSGSAPPAFPRNGISPRLRDAAHQAAR
A0A8B9NWH6_BCL2L1-      ----------MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAVE
A0A8B9NWH6_BCL2L1-      ----------MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAVE
A0A8B9PRT7_BCL2-01      ----MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASGDRAPASPGLSPP
A0A8B9PRT7_BCL2-02      ----MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASGDRAPASPGLSPP
                                                   :                      

A0A8B9S513_BCL2A1-      -----------------------------------------------GPA
A0A8B9P3N9_MCL1-01      SGADRLVPG---------APGPPGVDELRQDSLELIGRYLREAAGEAEPG
A0A8B9NWH6_BCL2L1-      AGMAGVLNG---------SPSW-------------------------HPP
A0A8B9NWH6_BCL2L1-      AGMAGVLNG---------SPSW-------------------------HPP
A0A8B9PRT7_BCL2-01      AAAALAAAGTSSDHTGLVSPHP-------------------------EPP
A0A8B9PRT7_BCL2-02      AAAALAAAGTSSDHTGLVSPHP-------------------------EPP
                                                                        * 

A0A8B9S513_BCL2A1-      QTRVAH----------------------VLRNIAFSLQDQTEEALRPFLD
A0A8B9P3N9_MCL1-01      AKKLFPGLLGGPGRPGGAGDGVMEKALETLRRVGNGVMQKHELAFQGMLR
A0A8B9NWH6_BCL2L1-      ASHIVNGAAVHRSSLEVHEIVQAADVRQALREAGDEFELRYRRAFSDLTS
A0A8B9NWH6_BCL2L1-      ASHIVNGAAVHRSSLEVHEIVQAADVRQALREAGDEFELRYRRAFSDLTS
A0A8B9PRT7_BCL2-01      GSAAASNAAPGDGLRPAPPVVHL-----ALRQAGDEFSRRYQRDFAQMSG
A0A8B9PRT7_BCL2-02      GSAAASNAAPGDGLRPAPPVVHL-----ALRQAGDEFSRRYQRDFAQMSG
                         .                          .**  .  .  .    :  :  

A0A8B9S513_BCL2A1-      RIDITSVDVAKRIFNGVMEEKFADGNTNWGRIMTIFTFGGLLTKKLQEHG
A0A8B9P3N9_MCL1-01      KLEIKKEEDLQS-VCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSIN
A0A8B9NWH6_BCL2L1-      QLHITPGTAYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKE
A0A8B9NWH6_BCL2L1-      QLHITPGTAYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKE
A0A8B9PRT7_BCL2-01      QLHLTPFTARGR-FVAVVEELFRDGV-NWGRIVAFFEFGSVMCVESVNRE
A0A8B9PRT7_BCL2-02      QLHLTPFTARGR-FVAVVEELFRDGV-NWGRIVAFFEFGSVMCVESVNRE
                        .: :.        .  *    * **  ****::::: **. :     .  

A0A8B9S513_BCL2A1-      VQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRS-----
A0A8B9P3N9_MCL1-01      QEKC---ISSLAGIITDALVSSKREWLMSQGGWE-GFVDFFRVEDL----
A0A8B9NWH6_BCL2L1-      MRVL---VGRVVSWMTTYLTDHLDPWIQENGGWE-RFVDLYGNDAAAEMR
A0A8B9NWH6_BCL2L1-      MRVL---VGRVVSWMTTYLTDHLDPWIQENGGWE-RFVDLYGNDAAAEMR
A0A8B9PRT7_BCL2-01      MSPL---VDSIATWMTEYLNRHLHTWIQDNGGWD-AFVELYGNSMRPLFD
A0A8B9PRT7_BCL2-02      MSPL---VDSIATWMTEYLNRHLHTWIQDNGGWQ---VTPSRHHRRDVLD
                                  :   :*  :      *:  :***:   :            

A0A8B9S513_BCL2A1-      ---------------LLSLSKITAIFIAFFSLFREYY--
A0A8B9P3N9_MCL1-01      --------EGSIRNVLMAFAGVAGLGASLAYMIR-----
A0A8B9NWH6_BCL2L1-      KGQETFN-KW-----LLTGATVAGVLLLGSLLSRK----
A0A8B9NWH6_BCL2L1-      KGQETFN-KW-----LLTGATVAGVLLLGSLLSRK----
A0A8B9PRT7_BCL2-01      F-------SWISLKTILSLVLVGACITLGAYLGHK----
A0A8B9PRT7_BCL2-02      LRQTLRSPAWRSLP-------------------HRDVGV
                                                         .     

© 1998-2022Legal notice