Dataset for protein BCL-2-like of organism Apteryx owenii

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8B9NWH6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Apteryx owenii GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAVEAGMAGVLNGSPSWHPPASHIVNGAAVHRSSLEVHEIVQAA
DVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RVVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8B9NWH6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Apteryx owenii GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAVEAGMAGVLNGSPSWHPPASHIVNGAAVHRSSLEVHEIVQAA
DVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVG
RVVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8B9P3N9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Apteryx owenii GN=MCL-1 (length=358 residues).
SPWLFPHAPTSFGAGAILRQPRAGRERRAAGRSAGGLASAGDRRVDPWKVRRDGKPQGPLAGGSQRETPPAAAGVRLCSL
AGCSARRQPDLGCVEVREQGTKHSRGRPERDGAANPPKRAKPYPSGSAPPAFPRNGISPRLRDAAHQAARSGADRLVPGA
PGPPGVDELRQDSLELIGRYLREAAGEAEPGAKKLFPGLLGGPGRPGGAGDGVMEKALETLRRVGNGVMQKHELAFQGML
RKLEIKKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLMSQGGW
EGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIR
>gnl|bcl2dbpro|A0A8B9PRT7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Apteryx owenii GN=BCL-2 (length=238 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASGDRAPASPGLSPPAAAALAAAGTSSDHTGLVSPHPEPPGSAAASNAA
PGDGLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGSVMCVES
VNREMSPLVDSIATWMTEYLNRHLHTWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8B9PRT7_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Apteryx owenii GN=BCL-2 (length=228 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASGDRAPASPGLSPPAAAALAAAGTSSDHTGLVSPHPEPPGSAAASNAA
PGDGLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGSVMCVES
VNREMSPLVDSIATWMTEYLNRHLHTWIQDNGGWQVTPSRHHRRDVLDLRQTLRSPAWRSLPHRDVGV
>gnl|bcl2dbpro|A0A8B9S513_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Apteryx owenii GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAHDYLQYVLQESHLGPAQTRVAHVLRNIAFSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSLSKIT
AIFIAFFSLFREYY
© 1998-2022Legal notice