Dataset for protein Mcl-1 of organism Anolis carolinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTL
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
EVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************************************************************:           .
VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWqrarlgsatlrih
                                                                   eg----------f
                                                                                

       330       340       350     
....:....|....:....|....:....|....:
:: . :  ::  :. *:* .. :..  .   :   
leavtlvflnfqvqaVfVrhgflgsergkqqhtcv
vqffhvedieggirn l afasvagigaglaynir
                                m p
© 1998-2022Legal notice