Dataset for protein Mcl-1 of organism Anolis carolinensis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A803T0A4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anolis carolinensis GN=MCL-1 (length=355 residues).
MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTL
EVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWQRARLGSATLRIH
LEAVTLVFLNFQVQAVFVRHGFLGSERGKQQHNCV
>gnl|bcl2dbpro|A0A803T0A4_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anolis carolinensis GN=MCL-1 (length=345 residues).
MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTL
EVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWEGFVQFFHVEDIE
GGIRNVLVAFASVAGIGAGLAYMIR
>gnl|bcl2dbpro|A0A803T0A4_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anolis carolinensis GN=MCL-1 (length=355 residues).
MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTL
EVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWQRARLGSATLRIH
LEAVTLVFLNFQVQAVFVRHGFLGSERGKQQHTCP
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice