Dataset for protein Mcl-1 of organism Anolis carolinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H9GEA6_MCL1-02      ----------------MAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRP
H9GEA6_MCL1-01      MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRP
                                    ********************************************

H9GEA6_MCL1-02      LIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEE
H9GEA6_MCL1-01      LIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEE
                    ************************************************************

H9GEA6_MCL1-02      EAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTLEVVGRYLREAADEAGSKGTG
H9GEA6_MCL1-01      EAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTLEVVGRYLREAADEAGSKGTG
                    ************************************************************

H9GEA6_MCL1-02      PKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
H9GEA6_MCL1-01      PKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
                    ************************************************************

H9GEA6_MCL1-02      VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREW
H9GEA6_MCL1-01      VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREW
                    ************************************************************

H9GEA6_MCL1-02      LLKHNAWEGFVQFFHVEDIEGGIRNVLVAFASVAGIGAGLAYMIR
H9GEA6_MCL1-01      LLKHNAWHNCV----------------------------------
                    ******* . *                                  

© 1998-2020Legal notice