Dataset for protein Bcl-2 of organism Anabas testudineus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mqtalsrgervqhgtlirllhifdslpnqrttppptsvfrhplsgpspasylgyrtpeagllvsrrandcqispmsseeg
                                                                           man c
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 .*  *        .. :.* *  :. .. . ** .*   ..*.  * 
---------------------------mllviaaFivAfvlllymisplisPkPlklngahvvvTGgsSgigkcIaieCy
lsstitdwlfinlskrgyswwlllpfi------g hd qdedaanngsavp p tlvrrcreas  pd ---ds pqh r
nrnivekyichk      a                                                             
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*                                     :  *. :: :  *:.:    :           .         
RqgafitlvarneakllqakkeiekfaindkqvvlcisvdvSsdysqvesVikqaqeklg--------pvdmlvncagts
 -------------------------------------lpp dphaalhr lre---hftrlyqpdftemstqlylwsyt
                                                       gde e         d riak tp f
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            ..                                                                  
msgkfeevevdcfkklmevnylgsvyptravittmkerrmgrimfvssqagqvglfgytayspskfalrglaeslqmeik
------------hr------------------------------------------------------------------
aqrr a  idel q                                                                  
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pyniyvtvayppdtdtpglaeenktkpletklisetsgvcqpdqvakiivrdavqgnfnssvgpdgymlsaltcgmspvt
--------------------------------------------------------------------------------
                                                     i                          
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 :.:  :*.          :                            
siteglqqiitmglfr----------------tialfylGsfdsivrrcmiqreqskaadkre-----------------
-----------v----rqresvfscswssiktvfgfaef g--tviveylskk----------ewmteylngplhswiqd
   m  frddg-nwyd                i    a  aasltcga aa e mtpqvnnia                 
         af d g                                                                 

       490       500       510       520         
....:....|....:....|....:....|....:....|....:....
                                                 
-------------------------------------------------
nggwdafvdlydrqresvfscswssiktvfglaalgaasltigaylaqk
                                                 
                                                 
© 1998-2022Legal notice