Dataset for protein Bcl-2 of organism Anabas testudineus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mqtalsrgervqhgtlirllhifdslpnqrttppptsvfrhplsgpspasylgyrtpeagllvsrrandcqispmsseeg
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         :*      ::  *:   * .              * : *: ..   :. .:*: :
---------------------mllviAafivafvlllYmispLispkplklngahvvvtGgssGigkciaiecyrqGafi
lsstitdwlfinswwlllpfi----m necnrnivek ichk sk-------------r yaw fhdaqdedaann sav
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.                            *  :  *. :: :  *:.:    :                         . 
tlvarneakllqakkeiekfaindkqvvlCisvdvSsdysqvesVikqaqeklgpvdmlvncagtsmsgkfeevevdcfk
p----pp-------------------pqh rrlpp dphaalhr lre---hf-------------------------ht
       pt vrrcr astgpds si                       gde t dstiak wpyf      rlyqpd q

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
klmevnylgsvyptravittmker-----rmgrimfvssqagqvglfgytayspskfalrglaeslqmeikpyniyvtva
------------------------frdgv---------------------------------------------------
emsrql  t ttaq rfaevid l     nw   iaffefg t cvecaskeemt                         

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
yppdtdtpglaeenktkpletklisetsgvcqpdqvakiivrdavqgnfnssvgpdgymlsaltcgmspvtsiteglqqi
-------------------------------------------------------------------------------d
  qvnniaewmt ylng  hs w qdng w              i                             m  fr-

       410       420       430       440       450    
....:....|....:....|....:....|....:....|....:....|....
                       .:.*  **: .  :   : *.          
itmglfr----------------tiaLfyLGsfdsivrrcmiQreqskaadkre
afvd-ydrqresvfscswssiktvfg aa  aasltigayla k----------
---- --                                               
© 1998-2022Legal notice