Dataset for protein Bcl-2 of organism Anabas testudineus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A7N6A4C8_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anabas testudineus GN=BCL-2 (length=338 residues).
MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARNEAKLLQAKKEIEKFA
INDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVDCFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQVGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVDLYDRQRESVFSCSWSSIKTVFG
LAALGAASLTIGAYLAQK
>gnl|bcl2dbpro|A0A7N6A4C8_BCL2-04 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anabas testudineus GN=BCL-2 (length=317 residues).
MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARNEAKLLQAKKEIEKFA
INDKQVVLCISVDVSSDYSQVESVIKQHFTPDSTIAKCWPYFHQKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQA
GQVGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIV
RDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIITMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A7N6A4C8_BCL2-05 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anabas testudineus GN=BCL-2 (length=297 residues).
MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARNEAKLLQAKKEIEKFA
INDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVDCFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQVGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPDQVAKIIVRDAIITMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A7N6A4C8_BCL2-06 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anabas testudineus GN=BCL-2 (length=268 residues).
MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFITLVARNEAKLLQAKKEIEKFA
INDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVDCFKIKPYNIYVTVAYPPDTDTPGL
AEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIITMGLFRTIA
LFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A7N6A4C8_BCL2-07 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anabas testudineus GN=BCL-2 (length=186 residues).
MSSEEGLSSTITDWLFINSWWLLLPFIMLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
RQGAFITLVARNEVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVDCFKIITMGLFRTIALF
YLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A7N6A4C8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anabas testudineus GN=BCL-2 (length=228 residues).
MANECNRNIVEKYICHKLSKRGYAWGFHDAQDEDAANNGSAVPPPPTLVRRCREASTGPDSDSIPQHCRRLPPSDPHAAL
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASKEEMTPQVNN
IAEWMTEYLNGPLHSWIQDNGGWDAFVDLYDRQRESVFSCSWSSIKTVFGLAALGAASLTIGAYLAQK
>gnl|bcl2dbpro|A0A7N6A4C8_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anabas testudineus GN=BCL-2 (length=433 residues).
MQTALSRGERVQHGTLIRLLHIFDSLPNQRTTPPPTSVFRHPLSGPSPASYLGYRTPEAGLLVSRRANDCQISPMSSEEG
LSSTITDWLFINSWWLLLPFIMLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYRQGAFI
TLVARNEAKLLQAKKEIEKFAINDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVDCFK
KLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQVGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDT
DTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIITMGL
FRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
© 1998-2022Legal notice