Dataset for protein Bcl-2 of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N6A4C8_BCL2-03      MQTALSRGERVQHGTLIRLLHIFDSLPNQRTTPPPTSVFRHPLSGPSPAS
A0A7N6A4C8_BCL2-04      --------------------------------------------------
A0A7N6A4C8_BCL2-06      --------------------------------------------------
A0A7N6A4C8_BCL2-02      --------------------------------------------------
A0A7N6A4C8_BCL2-05      --------------------------------------------------
A0A7N6A4C8_BCL2-07      --------------------------------------------------
A0A7N6A4C8_BCL2-01      --------------------------------------------------
                                                                          

A0A7N6A4C8_BCL2-03      YLGYRTPEAGLLVSRRANDCQISPMSSEEGLSSTITDWLFIN------SW
A0A7N6A4C8_BCL2-04      --------------------------------------------------
A0A7N6A4C8_BCL2-06      --------------------------------------------------
A0A7N6A4C8_BCL2-02      --------------------------------------------------
A0A7N6A4C8_BCL2-05      --------------------------------------------------
A0A7N6A4C8_BCL2-07      ------------------------MSSEEGLSSTITDWLFIN------SW
A0A7N6A4C8_BCL2-01      -------------------------MANECNRNIVEKYICHKLSKRGYAW
                                                                          

A0A7N6A4C8_BCL2-03      WLLLPFIMLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSG
A0A7N6A4C8_BCL2-04      -------MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSG
A0A7N6A4C8_BCL2-06      -------MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSG
A0A7N6A4C8_BCL2-02      -------MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSG
A0A7N6A4C8_BCL2-05      -------MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSG
A0A7N6A4C8_BCL2-07      WLLLPFIMLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSG
A0A7N6A4C8_BCL2-01      -------------GFHDAQDEDAANNGSAVPPPPTLVRRCREASTGPDS-
                                     .*  *        .. :.* *  :. .. . ** .* 

A0A7N6A4C8_BCL2-03      IGKCIAIECYRQGAFITLVARNEAKLLQAKKEIEKFAINDKQVVLCISVD
A0A7N6A4C8_BCL2-04      IGKCIAIECYRQGAFITLVARNEAKLLQAKKEIEKFAINDKQVVLCISVD
A0A7N6A4C8_BCL2-06      IGKCIAIECYRQGAFITLVARNEAKLLQAKKEIEKFAINDKQVVLCISVD
A0A7N6A4C8_BCL2-02      IGKCIAIECYRQGAFITLVARNEAKLLQAKKEIEKFAINDKQVVLCISVD
A0A7N6A4C8_BCL2-05      IGKCIAIECYRQGAFITLVARNEAKLLQAKKEIEKFAINDKQVVLCISVD
A0A7N6A4C8_BCL2-07      IGKCIAIECYRQGAFITLVARNE-------------------VVLCISVD
A0A7N6A4C8_BCL2-01      --DSIPQHCRR-------------------------------------LP
                          ..*.  * *                                     : 

A0A7N6A4C8_BCL2-03      VSSDYSQVESVIKQAQEKLG--------PVDMLVNCAGTSMSGKFEEVEV
A0A7N6A4C8_BCL2-04      VSSDYSQVESVIKQ---HFT--------PDSTIAKCWPYF----------
A0A7N6A4C8_BCL2-06      VSSDYSQVESVIKQAQEKLG--------PVDMLVNCAGTSMSGKFEEVEV
A0A7N6A4C8_BCL2-02      VSSDYSQVESVIKQAQEKLG--------PVDMLVNCAGTSMSGKFEEVEV
A0A7N6A4C8_BCL2-05      VSSDYSQVESVIKQAQEKLG--------PVDMLVNCAGTSMSGKFEEVEV
A0A7N6A4C8_BCL2-07      VSSDYSQVESVIKQAQEKLG--------PVDMLVNCAGTSMSGKFEEVEV
A0A7N6A4C8_BCL2-01      PSDPHAALHRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVID
                         *. :: :  *:.:    :           .                   

A0A7N6A4C8_BCL2-03      DCFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQVGLFGYTA
A0A7N6A4C8_BCL2-04      --HQKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQVGLFGYTA
A0A7N6A4C8_BCL2-06      DCFK----------------------------------------------
A0A7N6A4C8_BCL2-02      DCFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQVGLFGYTA
A0A7N6A4C8_BCL2-05      DCFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQVGLFGYTA
A0A7N6A4C8_BCL2-07      DCFK----------------------------------------------
A0A7N6A4C8_BCL2-01      ELFR----------------------------------------------
                          ..                                              

A0A7N6A4C8_BCL2-03      YSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLET
A0A7N6A4C8_BCL2-04      YSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLET
A0A7N6A4C8_BCL2-06      ------------------IKPYNIYVTVAYPPDTDTPGLAEENKTKPLET
A0A7N6A4C8_BCL2-02      YSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLET
A0A7N6A4C8_BCL2-05      YSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLET
A0A7N6A4C8_BCL2-07      --------------------------------------------------
A0A7N6A4C8_BCL2-01      --------------------------------------------------
                                                                          

A0A7N6A4C8_BCL2-03      KLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVT
A0A7N6A4C8_BCL2-04      KLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVT
A0A7N6A4C8_BCL2-06      KLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVT
A0A7N6A4C8_BCL2-02      KLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVT
A0A7N6A4C8_BCL2-05      KLISETSGVCQPDQVAKIIVRDAI--------------------------
A0A7N6A4C8_BCL2-07      --------------------------------------------------
A0A7N6A4C8_BCL2-01      --------------------------------------------------
                                                                          

A0A7N6A4C8_BCL2-03      SITEGLQQIITMGLFR----------------TIALFYLGSFDSIVRRCM
A0A7N6A4C8_BCL2-04      SITEGLQQIITMGLFR----------------TIALFYLGSFDSIVRRCM
A0A7N6A4C8_BCL2-06      SITEGLQQIITMGLFR----------------TIALFYLGSFDSIVRRCM
A0A7N6A4C8_BCL2-02      SITEGLQQDAFVDLYDRQRESVFSCSWSSIKTVFGLAALGAASLTIGAYL
A0A7N6A4C8_BCL2-05      -ITMGLFR------------------------TIALFYLGSFDSIVRRCM
A0A7N6A4C8_BCL2-07      --------IITMGLFR----------------TIALFYLGSFDSIVRRCM
A0A7N6A4C8_BCL2-01      ---------DGVNWGR----------------IIAFFEFGG--TVCVECA
                                                         :.:  :*.         

A0A7N6A4C8_BCL2-03      IQREQSKAADKRE-------------------------------------
A0A7N6A4C8_BCL2-04      IQREQSKAADKRE-------------------------------------
A0A7N6A4C8_BCL2-06      IQREQSKAADKRE-------------------------------------
A0A7N6A4C8_BCL2-02      AQK-----------------------------------------------
A0A7N6A4C8_BCL2-05      IQREQSKAADKRE-------------------------------------
A0A7N6A4C8_BCL2-07      IQREQSKAADKRE-------------------------------------
A0A7N6A4C8_BCL2-01      SKEEMTPQVNNIAEWMTEYLNGPLHSWIQDNGGWDAFVDLYDRQRESVFS
                         :                                                

A0A7N6A4C8_BCL2-03      -----------------------------
A0A7N6A4C8_BCL2-04      -----------------------------
A0A7N6A4C8_BCL2-06      -----------------------------
A0A7N6A4C8_BCL2-02      -----------------------------
A0A7N6A4C8_BCL2-05      -----------------------------
A0A7N6A4C8_BCL2-07      -----------------------------
A0A7N6A4C8_BCL2-01      CSWSSIKTVFGLAALGAASLTIGAYLAQK
                                                     

© 1998-2022Legal notice