Dataset for protein Bcl-2 of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N6A4C8_BCL2-07      --------------------------------------------------
A0A7N6A4C8_BCL2-03      MQTALSRGERVQHGTLIRLLHIFDSLPNQRTTPPPTSVFRHPLSGPSPAS
A0A7N6A4C8_BCL2-01      --------------------------------------------------
A0A7N6A4C8_BCL2-04      --------------------------------------------------
A0A7N6A4C8_BCL2-06      --------------------------------------------------
A0A7N6A4C8_BCL2-02      --------------------------------------------------
A0A7N6A4C8_BCL2-05      --------------------------------------------------
                                                                          

A0A7N6A4C8_BCL2-07      ------------------------MSSEEGLSSTITDWLFINSWWLLLPF
A0A7N6A4C8_BCL2-03      YLGYRTPEAGLLVSRRANDCQISPMSSEEGLSSTITDWLFINSWWLLLPF
A0A7N6A4C8_BCL2-01      --------------------------------------------------
A0A7N6A4C8_BCL2-04      --------------------------------------------------
A0A7N6A4C8_BCL2-06      --------------------------------------------------
A0A7N6A4C8_BCL2-02      --------------------------------------------------
A0A7N6A4C8_BCL2-05      --------------------------------------------------
                                                                          

A0A7N6A4C8_BCL2-07      IMLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIA
A0A7N6A4C8_BCL2-03      IMLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIA
A0A7N6A4C8_BCL2-01      -----MANECNRNIVEKYICHKLSK-------------RGYAWGFHDAQD
A0A7N6A4C8_BCL2-04      -MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIA
A0A7N6A4C8_BCL2-06      -MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIA
A0A7N6A4C8_BCL2-02      -MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIA
A0A7N6A4C8_BCL2-05      -MLLVIAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIA
                             :*      ::  *:   * .              * : *: ..  

A0A7N6A4C8_BCL2-07      IECYRQGAFITLVARNE-------------------VVLCISVDVSSDYS
A0A7N6A4C8_BCL2-03      IECYRQGAFITLVARNEAKLLQAKKEIEKFAINDKQVVLCISVDVSSDYS
A0A7N6A4C8_BCL2-01      EDAANNGSAVP----PPPTLVRRCREASTGPDSDSIPQHCRRLPPSDPHA
A0A7N6A4C8_BCL2-04      IECYRQGAFITLVARNEAKLLQAKKEIEKFAINDKQVVLCISVDVSSDYS
A0A7N6A4C8_BCL2-06      IECYRQGAFITLVARNEAKLLQAKKEIEKFAINDKQVVLCISVDVSSDYS
A0A7N6A4C8_BCL2-02      IECYRQGAFITLVARNEAKLLQAKKEIEKFAINDKQVVLCISVDVSSDYS
A0A7N6A4C8_BCL2-05      IECYRQGAFITLVARNEAKLLQAKKEIEKFAINDKQVVLCISVDVSSDYS
                         :. .:*: :.                            *  :  *. ::

A0A7N6A4C8_BCL2-07      QVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVDCFK----------
A0A7N6A4C8_BCL2-03      QVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVDCFKKLMEVNYLGS
A0A7N6A4C8_BCL2-01      ALHRVLREAGDEL------------------ERLYQPDFTEMSRQLYLTS
A0A7N6A4C8_BCL2-04      QVESVIKQ---HFTPDSTIAKCWPYF------------HQKLMEVNYLGS
A0A7N6A4C8_BCL2-06      QVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVDCFK----------
A0A7N6A4C8_BCL2-02      QVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVDCFKKLMEVNYLGS
A0A7N6A4C8_BCL2-05      QVESVIKQAQEKLGPVDMLVNCAGTSMSGKFEEVEVDCFKKLMEVNYLGS
                         :  *:.:    :                         .           

A0A7N6A4C8_BCL2-07      --------------------------------------------------
A0A7N6A4C8_BCL2-03      VYPTRAVITTMKER-----RMGRIMFVSSQAGQVGLFGYTAYSPSKFALR
A0A7N6A4C8_BCL2-01      TTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASKEEMT-----
A0A7N6A4C8_BCL2-04      VYPTRAVITTMKER-----RMGRIMFVSSQAGQVGLFGYTAYSPSKFALR
A0A7N6A4C8_BCL2-06      --------------------------------------------------
A0A7N6A4C8_BCL2-02      VYPTRAVITTMKER-----RMGRIMFVSSQAGQVGLFGYTAYSPSKFALR
A0A7N6A4C8_BCL2-05      VYPTRAVITTMKER-----RMGRIMFVSSQAGQVGLFGYTAYSPSKFALR
                                                                          

A0A7N6A4C8_BCL2-07      --------------------------------------------------
A0A7N6A4C8_BCL2-03      GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGV
A0A7N6A4C8_BCL2-01      ---------------------PQVNNIAEWMTEYLNGPLHS-WIQDNGGW
A0A7N6A4C8_BCL2-04      GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGV
A0A7N6A4C8_BCL2-06      ---------IKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGV
A0A7N6A4C8_BCL2-02      GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGV
A0A7N6A4C8_BCL2-05      GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGV
                                                                          

A0A7N6A4C8_BCL2-07      -------------------------------------------------I
A0A7N6A4C8_BCL2-03      CQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQI
A0A7N6A4C8_BCL2-01      -------------------------------------------------D
A0A7N6A4C8_BCL2-04      CQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQI
A0A7N6A4C8_BCL2-06      CQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQI
A0A7N6A4C8_BCL2-02      CQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQD
A0A7N6A4C8_BCL2-05      CQPDQVAKIIVRDAI---------------------------ITMGLFR-
                                                                          

A0A7N6A4C8_BCL2-07      ITMGLFR----------------TIALFYLGSFDSIVRRCMIQREQSKAA
A0A7N6A4C8_BCL2-03      ITMGLFR----------------TIALFYLGSFDSIVRRCMIQREQSKAA
A0A7N6A4C8_BCL2-01      AFVDLYDRQRESVFSCSWSSIKTVFGLAALGAASLTIGAYLAQK------
A0A7N6A4C8_BCL2-04      ITMGLFR----------------TIALFYLGSFDSIVRRCMIQREQSKAA
A0A7N6A4C8_BCL2-06      ITMGLFR----------------TIALFYLGSFDSIVRRCMIQREQSKAA
A0A7N6A4C8_BCL2-02      AFVDLYDRQRESVFSCSWSSIKTVFGLAALGAASLTIGAYLAQK------
A0A7N6A4C8_BCL2-05      -----------------------TIALFYLGSFDSIVRRCMIQREQSKAA
                                               .:.*  **: .  :   : *.      

A0A7N6A4C8_BCL2-07      DKRE
A0A7N6A4C8_BCL2-03      DKRE
A0A7N6A4C8_BCL2-01      ----
A0A7N6A4C8_BCL2-04      DKRE
A0A7N6A4C8_BCL2-06      DKRE
A0A7N6A4C8_BCL2-02      ----
A0A7N6A4C8_BCL2-05      DKRE
                            

© 1998-2022Legal notice