Dataset for protein BCL-2-like of organism Ailuropoda melanoleuca

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------sgg--s-ggrll-----------------------
mahagrtgydnreivmkyihymfglkrnaviglnlycgpaglgpm---as-s-----gsgkwrtsrrpigqrggwkvtgg
                     klsqrgyewdamhtgipgpstpagphipaprtt tpal ceara  ea ggeagamidc
                                gdaeaa   aa aadalreqpa  f                       
                                                f  a                            
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------pa--------------------------------------------------------adyvgyklrq------
spgmtt--slapdtralvrpspigaegpdvtatpprllfleptrrasppeemegpaadaimspettfakhaaqplgkrpa
efayastpt    a rva                                              qpllpdvppl      
aa rsp lp                                                       pegdeaekei      
   a l  a                                                       e a   c ae      
                                                                         a      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   .                                            .        :* ..  
-----------------agp-----------------------------------------gsgpasdplh--lRrvgdg
vlpllelvgeakgyvcgpqslpstpppaeeeedelyrqsleiisrylreqatgakdakplgpeaavaavevqtm aaase
           s gp tg t                                         aasssrtsvtla  s  as
                 d                                            lr rprlqlev  q   q
                                                                 pkpkaaa   d   d
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
..                  .:                         .***:*::: * . :                  
vqrrhe------rtfsgmlrqlhvtpedavqr-ftqvmvelfsdg--nWGRiValfvFgaflckesvske----------
fetnfrrflsdytayqdlaakfdikngsdqksilsrpsehv-qg-vts   l tfis egavaahlkninysnlgpdqel
 sqey       knlkpnsvs vlvvvtsrrt hpt vd-- -- ip    v  ilt a vmtvr prrti         
  g v        g gecrse  aqsfreila  n  l-ke r   i         e   t lek l gr          
             d a   d         ag   a       e             a   i       e           
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .     :   :   :      *:    ** :                                       
---------meplvgqlaewmteylvttlrdWivssgGW-d---------------------------------------
elgeweagvqsgciepvqysivdvitrrkat lhkqr  eeleaikarvremeeeaeklkelqnevekqmnmspppgnag
         rqvd-srivlfvcar egqmhe  rqnd                                           
         pdd arn sd lanf n nh a  qdh                                            
              dh           h     ea                                             
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   .                                          :                 
-------------------gfvef-f-veele------gsvrrvlllf-----lkvsgvpkglayl-------vr-----
pvimsieekmeadarsiyvancdygatapd--ahfhgc-ginnswiackallsdgfafhgatfisiefsdkeslktslal
                      ll yh---mq      slwksltatl     alsv tivimgay       igryc  
                      kk   t s p      pepdfg  sa      elt kcie f f       w ql   
                           g m          f     q       a c aac              hk   
                                                                                

       490       500       510       520       530       540       550    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
                                                                          
--------------------------------------------------------------------------
deslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
                                                                      fl  
                                                                          
                                                                          
                                                                          
© 1998-2022Legal notice