Dataset for protein BCL-2-like of organism Ailuropoda melanoleuca

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                        :               .                       
                 m ha rtgydnreivmky--phl qssttwrwqvmptscsrpptralvxdfvgxklrqkgxvc
                                   iym d p plalllar lep   ed                    
                                     i      f  d      a                         

        90       100       110       120       130       140       150       160
   *   . .                                                                      
aet dlsattdrvlfleptrrasppeemegpaadaimspeeeldgyepeplgkrpavlpllelvgeasggpctdgslpst
gg  grg sa paav                                                                 
     ea a  e  q                                                                 

       170       180       190       200       210       220       230       240
                                                 :* ..  .. ..   :               
pppaeeeedelyrqsleiisrylreqatgakdakplggsgaasrkale-m qaaadfstnyetalqeylrk-dikneddr
                                                a  s   q eq f  t adlrg- -----y q
                                                   a   e       f    aa   v  gs g

       250       260       270       280       290       300       310       320
     :   :            .***:*::: *.. :     .   .                           :   * 
kslarlmehlesgilahpqppts   v tfie aafmakhlkninqegcidniqeelgeweagvrqdcrhlvdsivdv n
qnrvq sdq  qe       l     l   lv   tller p kty n gpqve                   flcnr t
   te  a                       t   a  a    g      gdq                       a  e

       330       340       350       360       370       380  
     *:    **     :                                           
thkht iqdnr  veatpfygpsaleeh-ed---gi-nl-a-f-la-g----ia-ga-lrsk
grhaa  hssd  aa rl e dg    mt--rps--l--r-v-t--valt v--v--ykgll
 q     eah      ca         arrmfdfn kr ktqas sl f  lvllyfwfah 
                            q       a    l l  c    c  i  f    
© 1998-2020Legal notice