Dataset for protein BCL-2-like of organism Ailuropoda melanoleuca

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       * ... :    *  :*   *   .**..***..*            **                         
-----mfGlkrnav----IglnLycgGaglgAGsgGAAssG------------GRll-----------------------
mahagrt ydnreivmky hyk sqr yewd  da   pp aapapgifssqp  tpasgkeatarreigggeagavigg

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
sagasppatlapdarrvarpspigaegpdvtatpprllfleptrrasppeemegpaadaimspeeeldgyepeplgkrpa

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  *.. ... *  .: **:  *          
--------------------------------------------------AtgakdakPlggsgAAsrkA----------
vlpllelvgeasggpctdgslpstpppaeeeedelyrqsleiisrylreq partspp ppaap  aaa gpalspvppv

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   ***..**...*.:   *  *  :* :.       :: *:  :* *** ******:::.**..:.    . : .  ::
-leTLRrvGDgvqRnhetaFqgMlrkLdikneddvkslsrVmvhvFsDGVtNWGRIVtlisFGafvakhlksinqegcie
vhl   qa  dfs ryrrd ae ssq hltpftargrfat veel r   -      affe  gvmcvesvnremsplvd

       330       340       350       360       370       380        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
 :*  :*: * *  . *: .: ***.***::      : *:.    :.**::* *..  :  *** . 
plAesiTdvLvRtkrdWlvkqrGWDgFVEff-----hveDleggirnvLLafAgVagvgaglAYLir-
ni lwm ey n hlht iqdng   a   lygpsmqplf fswlslka  sl l gacitlg   ghk
© 1998-2022Legal notice