Dataset for protein BCL-2-like of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A7N5JVN3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L10 (length=193 residues).
MADALRERTARLLTDYLEYCAREPGTPARAPSTPEAAVLRSVAAQVQQRHERFLSDYRGYGGNRVELVAQVEREILAHPQ
PLSWGRVVALLTFAGTLLERSPSGTYSNLGPDQELELGEWEAGVRQDCRHLVDFLCNRLTGQHRAWLEAHDGWDGFCLFF
TPMLPSSWKRLLAQALLSCFTAVILIYFWKRLL
>gnl|bcl2dbpro|G1L3L7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGAASSGGRLLASGKEATARREIGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPRLLFLEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGGPCTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G1L3L7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGAASSGGRLLATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G1LIC9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL-2 (length=234 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPAAPAAAAAAGPA
LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE
MSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|G1LIJ8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2A1 (length=218 residues).
MHTEIPPASTPPMSHGPSPAGTRLFGLGCWRRSRRPAGQRGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQV
LRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLRERISPDVDASR
ISYFVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVTGKICEMFSLLKQYC
>gnl|bcl2dbpro|G1LKF5_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|G1LKF5_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L2 (length=331 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWFL
© 1998-2022Legal notice