Dataset for protein BCL-2-like of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1L3L7_MCL1-01          ---------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGAA
G1LKF5_BCL2L2-02        --------------------------------------------------
G1LKF5_BCL2L2-01        --------------------------------------------------
G1LIC9_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFS
G1LIJ8_BCL2A1-01        --------------------------------MHTEIPPASTPPMSHGPS
A0A7N5JVN3_BCL2L10      --------------------------------------------MADALR
G1L3L7_MCL1-02          ---------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGAA
                                                                          

G1L3L7_MCL1-01          SSGGRLLASGKEATARREIGGGEAGAVIGGSAGASPPATLAPDARRVARP
G1LKF5_BCL2L2-02        ---------------------------------MATPAS-APDTRALV--
G1LKF5_BCL2L2-01        ---------------------------------MATPAS-APDTRALV--
G1LIC9_BCL2-01          SQPGRTP-----------------------APARTSPPP-----------
G1LIJ8_BCL2A1-01        PAGTRLFGLGCWRRSRRPAGQRGGWKMTDCEFGYTLTLA-----------
A0A7N5JVN3_BCL2L10      ERTARLL-------------------------------------------
G1L3L7_MCL1-02          SSGGRLL-------------------------------------------
                                                                          

G1L3L7_MCL1-01          SPIGAEGPDVTATPPRLLFLEPTRRASPPEEMEGPAADAIMSPEEELDGY
G1LKF5_BCL2L2-02        --------------------------------------------ADFVGY
G1LKF5_BCL2L2-01        --------------------------------------------ADFVGY
G1LIC9_BCL2-01          --------------------------------------------PPAAPA
G1LIJ8_BCL2A1-01        --------------------------------------------QDYVKH
A0A7N5JVN3_BCL2L10      --------------------------------------------TDYLEY
G1L3L7_MCL1-02          --------------------------------------------ATGAKD
                                                                          

G1L3L7_MCL1-01          EPEPLGKRPAVLPLLELVGEASGGPCTDGSLPSTPPPAEEEEDELYRQSL
G1LKF5_BCL2L2-02        KLRQ-----------------KGYVCGAGP--------------------
G1LKF5_BCL2L2-01        KLRQ-----------------KGYVCGAGP--------------------
G1LIC9_BCL2-01          AAAA-----------------------AGP--------------------
G1LIJ8_BCL2A1-01        VLQI-----------------------PQP--------------------
A0A7N5JVN3_BCL2L10      CARE-----------------------PGT--------------------
G1L3L7_MCL1-02          AKPL-----------------------GGS--------------------
                                                     .                    

G1L3L7_MCL1-01          EIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHE----
G1LKF5_BCL2L2-02        ---------------------GEGPAADPLHQAMRAAGDEFETRFR----
G1LKF5_BCL2L2-01        ---------------------GEGPAADPLHQAMRAAGDEFETRFR----
G1LIC9_BCL2-01          ---------------------ALSPVPPVVHLTLRQAGDDFSRRYR----
G1LIJ8_BCL2A1-01        ---------------------GSAPSRASQV--LRDVASSVQGEVE----
A0A7N5JVN3_BCL2L10      ---------------------PARAPSTPEAAVLRSVAAQVQQRHERFLS
G1L3L7_MCL1-02          ---------------------GAASRKALET--LRRVGDGVQRNHE----
                                                .        :* ..  ..        

G1L3L7_MCL1-01          --TAFQGMLRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWGRIVTLISFGA
G1LKF5_BCL2L2-02        --RTFSDLAAQLHVTPGSAQQR-FTQVSDELFQGG-PNWGRLVAFFVFGA
G1LKF5_BCL2L2-01        --RTFSDLAAQLHVTPGSAQQR-FTQVSDELFQGG-PNWGRLVAFFVFGA
G1LIC9_BCL2-01          --RDFAEMSSQLHLTPFTARGR-FATVVEELFRDGV-NWGRIVAFFEFGG
G1LIJ8_BCL2A1-01        --KNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEG
A0A7N5JVN3_BCL2L10      DYRGYGGNRVELVAQVEREILA-HPQPL---------SWGRVVALLTFAG
G1L3L7_MCL1-02          --TAFQGMLRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWGRIVTLISFGA
                                  .:                         .***:*::: * .

G1L3L7_MCL1-01          FVAKHLKSIN-------------------QEGCIEPLAESITDVLVRTKR
G1LKF5_BCL2L2-02        ALCAESVNKE-------------------MEPLVGQVQEWMVAYLETRLA
G1LKF5_BCL2L2-01        ALCAESVNKE-------------------MEPLVGQVQEWMVAYLETRLA
G1LIC9_BCL2-01          VMCVESVNRE-------------------MSPLVDNIALWMTEYLNRHLH
G1LIJ8_BCL2A1-01        ILTKKLLRERIS-----------------PDVDASRISYFVAEFITTNMR
A0A7N5JVN3_BCL2L10      TLLERSPSGTYSNLGPDQELELGEWEAGVRQDC-RHLVDFLCNRLTGQHR
G1L3L7_MCL1-02          FVAKHLKSIN-------------------QEGCIEPLAESITDVLVRTKR
                         :                            .     :   :   :     

G1L3L7_MCL1-01          DWLVKQRGW-D---------------------------------------
G1LKF5_BCL2L2-02        DWIHSSGGW-ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAG
G1LKF5_BCL2L2-01        DWIHSSGGW-ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAG
G1LIC9_BCL2-01          TWIQDNGGW-D---------------------------------------
G1LIJ8_BCL2A1-01        EWIRQNGGWED---------------------------------------
A0A7N5JVN3_BCL2L10      AWLEAHDGW-D---------------------------------------
G1L3L7_MCL1-02          DWLVKQRGW-D---------------------------------------
                         *:    ** :                                       

G1L3L7_MCL1-01          -------------------GFVEF-FHVEDLE------GGIRNVLLAF--
G1LKF5_BCL2L2-02        PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC--
G1LKF5_BCL2L2-01        PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC--
G1LIC9_BCL2-01          -------------------AFVEL-Y-GPSMQ------PLFDFSWLSLKA
G1LIJ8_BCL2A1-01        -------------------GFVKK-F-------------EPKSGWLTF--
A0A7N5JVN3_BCL2L10      -------------------GFCLF-F-TPMLP------SSWKRLLAQA--
G1L3L7_MCL1-02          -------------------GFVEF-FHVEDLE------GGIRNVLLAF--
                                           .                              

G1L3L7_MCL1-01          ---AGVAGVGAGLAYL-------IR-------------------------
G1LKF5_BCL2L2-02        ---DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRP
G1LKF5_BCL2L2-01        ---DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRP
G1LIC9_BCL2-01          LLSLALVGACITLGAY-------LGHK-----------------------
G1LIJ8_BCL2A1-01        ---LEVTGKICEMFSL-------LKQYC----------------------
A0A7N5JVN3_BCL2L10      ---LLSCFTAVILIYF-------WKRLL----------------------
G1L3L7_MCL1-02          ---AGVAGVGAGLAYL-------IR-------------------------
                                    :                                     

G1L3L7_MCL1-01          --------------------------------------------------
G1LKF5_BCL2L2-02        GISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSW
G1LKF5_BCL2L2-01        GISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSW
G1LIC9_BCL2-01          --------------------------------------------------
G1LIJ8_BCL2A1-01        --------------------------------------------------
A0A7N5JVN3_BCL2L10      --------------------------------------------------
G1L3L7_MCL1-02          --------------------------------------------------
                                                                          

G1L3L7_MCL1-01          ----
G1LKF5_BCL2L2-02        YSPY
G1LKF5_BCL2L2-01        FL--
G1LIC9_BCL2-01          ----
G1LIJ8_BCL2A1-01        ----
A0A7N5JVN3_BCL2L10      ----
G1L3L7_MCL1-02          ----
                            

© 1998-2022Legal notice