Dataset for protein BCL-2-like of organism Accipiter nisus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               : :  *                                                           
------mfavnrnavigfvlY------------------------------tlsqsvyawaaagrpehpralvgcgaapr
mahpgr----keelelyyny cgggpalapaspgggpapppppaaaaevpgk-ig-ga-----e----------------
      rsysm ti fk is                               - --r--s sql-erdpnptglsppe em
       gsd      d  h                                   k  d     deael pdfaae  aa

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             *.                                                 
aavppaa---a--speeeldgcesesergPasdsvpgtppgppepp----------------------------------
--l----rpg-lw----------ppawlp ggtvlsha--------dglrqdslelisrylreaageaepavkklfpgll
dg-lng aaa aaltssyhtyvvq hph   qhran -amhrssle                                  
   aa        gaqdd q ll   he    aa a    aegl                                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   .**  .. .  .    :  :  .: :         .  *    * **  ****::::: **
-------gsgdvvm-----tLRrvgdgvmqryerafqgmlrqlhitpetdlqs-fceVveevFsDGvtNWGRivtlfsFG
ggpgrpg----a--ekalea  qaasefsrkhrldlsqltskielqkveaykrivvq aahl r  n-    vmafit  
       vpqv-qtadvrqv  ni  slqlqtqe  rpfsgr d  sgavrg   ng mn k a           i e  
       ahei hl            ed      ad  d      f  a    ea                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. :     .            :   :*  :      *:  :***:  *:  :               *            
gfvckhlvsinqerl---vsslagwiTeylvsskreWiqsnGGWe-gFvdlfr-ndl----rnvlmaFa-----------
avlavesknremsvcgeeigrivyim daitrhlhp lmeq   dnr ltfygve--egsi---rpt sfswislkwllt
 lmt k qekgvrpt   keqvssf   nnn dn  dd      a  ek e -smaaev rsqls n       ti s
 a      dh  ql     d   a      id  a    a                a     kg el d           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         :   :                                                                  
-----gvaglgaslaym-r-------------------------------------------------------------
lvtvgkittmfsyvsski-nyyncwipslgwqgtefcsswdgscprpalllsmpgtlqetwqahprsahsfflsssqlkp
gal aacll  il grll evt                                                          
       ia   a fh                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
lslqvsmrlysygkspwkpeqfllnkatglgvpssssksccdsavlpcaawlkrcpaalgtrckpchpserldslpkshq
   l plciqcf drk gn                                                             
                                                                                

       490       500    
....:....|....:....|....
                        
------------------------
cprnpsehwgsalfppsrvhaqgw
                        
                        
© 1998-2022Legal notice