Dataset for protein BCL-2-like of organism Accipiter nisus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8B9M984_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Accipiter nisus GN=MCL-1 (length=329 residues).
MFAVKRNAVIGFNLYCGGGPALAPASPGGGPAPPPPPAAAAEVPGTLIGSVAAWAAAGRPEHPRALVGCGAAPRAALPPA
ARPGALWSPEEELDGCEPEAERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYLREAAGEAEPAVKKLFPGLLGGPGRP
GGSGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIQKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHL
KSINQERCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIRLQVPMRIY
CFGKRKWKN
>gnl|bcl2dbpro|A0A8B9M984_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Accipiter nisus GN=MCL-1 (length=477 residues).
MFAVKRNAVIGFNLYCGGGPALAPASPGGGPAPPPPPAAAAEVPGTLIGSVAAWAAAGRPEHPRALVGCGAAPRAALPPA
ARPGALWSPEEELDGCEPEAERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYLREAAGEAEPAVKKLFPGLLGGPGRP
GGSGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIQKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHL
KSINQERCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIRNVTNCWIP
SLGWQGTEFCSSWDGSCPRPALLLSMPGTLQETWQAHPRSAHSFFLSSSQLKPLSLLVSLCLQSYGDSPWGPEQFLLNKA
TGLGVPSSSSKSCCDSAVLPCAAWLKRCPAALGTRCKPCHPSERLDSLPKSHQCPRNPSEHWGSALFPPSRVHAQGW
>gnl|bcl2dbpro|A0A8B9N2I0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Accipiter nisus GN=BCL2L1 (length=230 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNGSPSWHPPASHVVNGAAMHRSSLEVHEIVQT
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
GRVVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8B9RWH9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Accipiter nisus GN=BCL-2 (length=247 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAAEDRAPLPPGLSPPAAAAAAVAAAAAAAAAAGTSSDHTGLVSPHPEPP
GSAAASHAPPAEGLPPAPQVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFE
FGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITL
GAYLGHK
>gnl|bcl2dbpro|A0A8B9RZD1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Accipiter nisus GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVAVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
AMFIAVFSLLREYY
© 1998-2022Legal notice